WO2009058661A1 - Use and production of citrate-stable neutral metalloproteases - Google Patents
Use and production of citrate-stable neutral metalloproteases Download PDFInfo
- Publication number
- WO2009058661A1 WO2009058661A1 PCT/US2008/080972 US2008080972W WO2009058661A1 WO 2009058661 A1 WO2009058661 A1 WO 2009058661A1 US 2008080972 W US2008080972 W US 2008080972W WO 2009058661 A1 WO2009058661 A1 WO 2009058661A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- composition
- neutral metalloprotease
- sequence
- npre
- variant
- Prior art date
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C11—ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
- C11D—DETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
- C11D3/00—Other compounding ingredients of detergent compositions covered in group C11D1/00
- C11D3/16—Organic compounds
- C11D3/38—Products with no well-defined composition, e.g. natural products
- C11D3/386—Preparations containing enzymes, e.g. protease or amylase
- C11D3/38618—Protease or amylase in liquid compositions only
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/48—Hydrolases (3) acting on peptide bonds (3.4)
- C12N9/50—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
- C12N9/52—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from bacteria or Archaea
- C12N9/54—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from bacteria or Archaea bacteria being Bacillus
Definitions
- the present invention provides methods and compositions comprising at least one neutral metalloprotease enzyme that has improved stability in the presence of a metal chelator.
- the neutral metalloprotease finds use in cleaning and other applications comprising citrate.
- the present invention provides methods and compositions comprising variant neutral metalloprotease(s) engineered to resist citrate-induced autolysis.
- Bacillus are Gram-positive bacteria that secrete a number of industrially useful enzymes, which can be produced cheaply in high volume by fermentation.
- Bacillus proteases are widely used in the textile, laundry and household industries (Galante, Current Organic Chemistry, 7:1399-1422, 2003; and Showell, Handbook of Detergents, Part D: Formulation, Hubbard (ed.), NY: Taylor and Francis Group, 2006). Highly efficient color and stain removal from laundry require proteases.
- liquid preparations of cleaning and washing reagents typically contain builders, surfactants, and metal chelators, which have a destabilizing effect on most proteases.
- thermolysin-like metalloproteases The molecular mechanism of autolysis of thermolysin-like metalloproteases has been reported (Eijsink et al, Nat Struct Biol, 2:374-379, 1995; van den Burg et al, Biotechnol Appl Bioeng, 30:35-40, 1999; and Vriend, J Comput Aided MoI Des, 7:367-396, 1993).
- the present invention provides methods and compositions comprising at least one neutral metalloprotease enzyme that has improved stability in the presence of a metal chelator.
- the neutral metalloprotease finds use in cleaning and other applications comprising citrate.
- the present invention provides methods and compositions comprising variant neutral metalloprotease(s) engineered to resist citrate-induced autolysis.
- the neutral metalloprotease variant is a Bacillus neutral metalloprotease variant having an amino acid sequence comprising substitutions at three, four or five positions selected from the group equivalent to positions 129, 130, 138, 190, and 220 of the amino acid sequence set forth as SEQ ID NO:3.
- the substitutions comprise multiple mutations selected from S129I/F130L/D220P, M138L/V190I/D220P, and S129I/F130L/M138L/V190I/D220P.
- the Bacillus is B, amyloliquefaciens.
- the neutral metalloprotease has at least about 45%, at least about 50%. at least about 53%, at least about 55%, at least about 57%, at least about 60%, at least about 63%, at least about 65%, at least about 67%. at least about 70%, at least about 73%, at least about 75%, at least about 77%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% amino acid identity with the neutral metalloprotease comprising the amino acid sequence set forth as SEQ ID NO: 3.
- the present invention also provides isolated nucleic acids encoding the neutral metalloprotease variants described herein, as well as expression vectors comprising the nucleic acids. Moreover, the present invention provides host cells comprising the expression vectors. In still further embodiments, the present invention provides neutral metalloprotease variants obtained from the host cells comprising the expression vectors.
- the present invention provides isolated B. amyloliquefaciens neutral metalloprotease variants having improved resistance to citrate-induced autolysis.
- the neutral metalloprotease variant has an amino acid sequence comprising substitutions at three, four or five positions selected from the group equivalent to positions 129, 130, 138, 190, and 220 of the amino acid sequence set forth as SEQ ID NO:3.
- isolated B. amyloliquefaciens neutral metalloprotease variants comprising multiple mutations of the amino acid sequence set forth as SEQ ID NO:3, wherein the multiple mutations are selected from S129I/F130L/D220P, M138L/V190I/D220P, and
- the isolated B. amyloliquefaciens neutral metalloprotease variants comprise the amino acid sequence set forth as SEQ ID NO:18 (S129I/F130L/D220P), SEQ ID NO:19 (M138L/V190I/D220P), or SEQ ID NO:20 (S129I/F130L/M138L/V190I/D220P).
- the present invention also provides isolated nucleic acids encoding the neutral metalloprotease variants described herein, as well as expression vectors comprising nucleic acids encoding the neutral metalloprotease variants. Moreover, the present invention provides host cells comprising the expression vectors.
- the present invention provides neutral metalloprotease variants obtained from the host cells comprising the expression vectors.
- the present invention provides methods for producing an enzyme having neutral metalloprotease activity, comprising: transforming a host cell with an expression vector comprising a nucleic acid encoding the neutral metalloprotease variants; and cultivating the transformed host cell under conditions suitable for the production of the neutral metalloprotease.
- Some embodiments of the present invention further comprise the step of harvesting the produced neutral metalloprotease.
- the host cell is a Bacillus species, while in particularly preferred embodiments the Bacillus species is B. subtilis.
- compositions comprising an isolated neutral metalloprotease variant having improved resistance to citrate-induced autolysis.
- the composition further comprises at least one calcium ion and/or at least one zinc ion.
- the composition further comprises citrate.
- the composition is a cleaning composition (e.g., detergent).
- the composition further comprises at least one additional enzyme or enzyme derivative selected from the group consisting of proteases, amylases, lipases, mannanases, pectinases, cutinases, oxidoreductases, hemicellulases, and cellulases.
- the composition comprises: at least about 0.0001 weight percent of the neutral metalloprotease variant; or from about 0.001 to about 0.5 weight percent of the neutral metalloprotease variant.
- Some compositions of the present invention further comprise at least one adjunct ingredient.
- the composition further comprises a sufficient amount of a pH modifier to provide the composition with a neat pH of from about 3 to about 5, the composition being essentially free of materials that hydrolyze at a pH of from about pH 3 to about pH 5.
- the materials that hydrolyze at a pH of from about pH 3 to about pH 5 comprise at least one surfactant.
- the surfactant is a sodium alkyl sulfate surfactant comprising an ethylene oxide moiety.
- the composition is a liquid.
- the present invention provides animal feed compositions comprising an isolated neutral metalloprotease variant having improved resistance to citrate-induced autolysis.
- textile processing compositions are provided comprising an isolated neutral metalloprotease variant having improved resistance to citrate-induced autolysis.
- leather processing compositions are provided comprising an isolated neutral metalloprotease variant having improved resistance to citrate-induced autolysis.
- the present invention provides methods of cleaning, comprising the step of contacting a surface and/or an article comprising a fabric (e.g., material) with a cleaning composition comprising an isolated neutral metalloprotease variant having improved resistance to citrate-induced autolysis.
- the methods further comprise the step of rinsing the surface and/or fabric after contacting the surface or material with the cleaning composition.
- Figure 1 illustrates the citrate-induced autolysis of Bacillus amyloliquefaciens neutral protease (NprE).
- Panel A provides a graph showing inactivation of 0.4 mg/ml protease as function of citrate concentration (0-250 mM), and calcium concentration (0-10 mM) in 0.1 M Tris-HCl, pH 8.4. The remaining activity was measured using succinylated-casein/TNBSA and is relative to the activity measured m the presence of 10 mM calcium chloride.
- Panel B depicts a 10% SDS-PAGE analysis illustrating the autolysis pattern of protease induced by citrate.
- NprE amyloliquefaciens neutral protease
- fragment 1 SEQ ID NO:13
- fragment 2 SEQ ID NO: 14
- fragment 3 SEQ ID NO: 15
- fragment 4 SEQ ID NO: 16
- fragment 5 SEQ ID NO: 17
- the N-termini of the autolytic fragments are highlighted in bold. The numbering corresponds to the positions of the mature form of NprE.
- Figure 3 provides representative figures illustrating the activity data obtained by screening all possible amino acid replacements at three positions in NprE for citrate sensitivity.
- Panel A provides data from the activity screen of position M138.
- Panel B provides data from the activity screen of position D220.
- Panel C provides data from the activity screen of position V 190. Screening was performed at 25 0 C for 60 minutes in the absence and presence of 50 mM citrate in 25 mM HEPES, pH 8.0.
- the y-scale is arbitrary and represents the increase relative to the wild type protein.
- Figure 4 provides a graph showing activity of the neutral protease variants as a function of citrate concentration and incubation time.
- Panel A illustrates the citrate concentration dependence of activity measured after 60 minutes at room temperature for the wild- type protease (•), V190I (o), M138L (T), D220P ( ⁇ ), M138L-D220P ( ⁇ ) and S129I-F130L-M138L-V190I- D220P ( ⁇ ).
- Panel B depicts a 10% SDS-PAGE analysis showing the effect of citrate on wild type NprE and the variant S129I-F130L-M138L-V190I-D220P. Approximately 0.4 mg/ml protein was incubated with increasing citrate concentration for 100 minutes at 4 0 C.
- Lanes 1-4 illustrate the autolysis pattern for wild type as a function of citrate (0 - 75 mM), and lanes 6 - 10 show intact (non-autolysed) S129I-F130L-M138L-V190I-D220P. Lanes 5 represents the standard molecular weight markers.
- Figure 5 provides a graph showing the thermostability of wild type and variant proteases.
- Panel A provides representative calorimetric profiles for 0.4 mg/ml of protease variants S 1291, D220E, V190I-D220P, S129I-F130L-D220P, and S129I-F130L-M138L-V190I-D220P in the presence of 130 mM citrate. Data was collected from 20-90 0 C at a scan rate of 200 °C/hr using Auto-Cap VP-DSC (MicroCal, Northampton, MA, USA). All data shown is corrected for buffer baseline. The buffer was 5 mM HEPES, pH 8.0.
- Panel B provides a bar graph for a number of single, double and triple protease variants showing the incremental increase in the thermal melting point (Tm' s) in the presence of 130 mM citrate, pH 8.0.
- Figure 6 provides a table listing the activity and thermostability of wild type NprE and variants thereof.
- Figure 7 provides the amino acid sequences of exemplary citrate-stable NprE variants of the present invention.
- Panel A provides the amino acid sequence of the S129I-F130L-D220P NprE variant (SEQ ID NO: 18).
- Panel B provides the amino acid sequence of the M 138L-V 1901- D220P NprE variant (SEQ ID NO: 19).
- Panel C provides the amino acid sequence of the S 1291- F130L-M138L-V190I-D220P NprE variant (SEQ ID NO:20).
- Figure 8 provides a graph of Kcat/Km versus pH, illustrating that both the wild type
- NprE and the quintuple NprE variant have optimum activity towards an AGLA substrate at pH 6.5.
- Figure 9 provides a graph of remaining NprE activity versus pH, illustrating that the addition of calcium stabilizes both the wild type NprE and the quintuple NprE variant (S 1291- F130L-M138L-V190I-D220P) at both low and high pH.
- the present invention provides methods and compositions comprising at least one neutral metalloprotease enzyme that has improved stability in the presence of a metal chelator.
- the neutral metalloprotease finds use in cleaning and other applications comprising citrate.
- the present invention provides methods and compositions comprising variant neutral metalloprotease(s) engineered to resist citrate-induced autolysis. Unless otherwise indicated, the practice of the present invention involves conventional techniques commonly used in molecular biology, microbiology, and recombinant DNA, which are within the skill of the art.
- proteolytic activity refers to a protein or peptide exhibiting the ability to hydrolyze peptides or substrates having peptide linkages.
- Many well known procedures exist for measuring proteolytic activity Kalisz, "Microbial Proteinases,” In: Fiechter (ed.), Advances in Biochemical Engineering/Biotechnology, 1988).
- proteolytic activity may be ascertained by comparative assays, which analyze the respective protease' s ability to hydrolyze a commercial substrate.
- Exemplary substrates useful in such analysis of protease or proteolytic activity include, but are not limited to di-methyl casein (Sigma C-9801), bovine collagen (Sigma C-9879), bovine elastin (Sigma E-1625), and bovine keratin (ICN Biomedical 902111). Colorimetric assays utilizing these substrates are well known in the art (See e.g., WO 99/34011; and U.S. Patent No. 6,376,450, both of which are incorporated herein by reference.
- the pNA assay See e.g., Del Mar et ah, Anal Biochem, 99:316-320, 1979) also finds use in determining the active enzyme concentration for fractions collected during gradient elution.
- This assay measures the rate at which p-nitroaniline is released as the enzyme hydrolyzes the soluble synthetic substrate, succinyl-alanine-alanine-proline-phenylalanine-p-nitroanilide (sAAPF-pNA).
- the rate of production of yellow color from the hydrolysis reaction is measured at 410 nm on a spectrophotometer and is proportional to the active enzyme concentration.
- absorbance measurements at 280 nm can be used to determine the total protein concentration. The active enzyme/total-protein ratio gives the enzyme purity.
- NprE protease refers to the neutral metalloproteases described herein.
- the NprE protease is the protease designated herein as purified MULTIFECT® Neutral or PMN obtained from Bacillus amyloliquefaciens.
- PMN protease refers to a naturally occurring mature protease derived from Bacillus amyloliquefaciens having substantially identical amino acid sequences as provided m SEQ ID NO:3.
- the present invention provides portions of the NprE protease.
- Bacillus protease homologies refers to naturally occurring proteases having substantially identical amino acid sequences to the mature protease derived from Bacillus amyloliquefaciens or polynucleotide sequences which encode for such naturally occurring proteases, and which proteases retain the functional characteristics of a neutral metalloprotease encoded by such nucleic acids.
- NprE variant and “NprE protease variant,” are used in reference to proteases that are similar to the wild-type NprE, particularly in their function, but have mutations in their amino acid sequence that make them different in sequence from the wild- type protease.
- Bacillus ssp refers to all of the species within the genus "Bacillus,” which are Gram-positive bacteria classified as members of the Family Bacillaceae, Order Bacillales, Class Bacilli.
- the genus "Bacillus” includes all species within the genus "Bacillus " as known to those of skill in the art, including but not limited to B. subtilis, B. licheniformis, B. lentus, B. brevis, B. stearothermophilus, B. alkalophilus, B. amyloliquefaciens, B. clausii, B. halodurans, B. megaterium, B. coagulans, B. circulans, B.
- Bacillus continues to undergo taxonomical reorganization.
- the genus include species that have been reclassified, including but not limited to such organisms as B.
- stearothermophilus which is now named "Geobacillus stearothermophilus.”
- the production of resistant endospores in the presence of oxygen is considered the defining feature of the genus Bacillus, although this characteristic also applies to the recently named Alicyclobacillus, Amphibacillus, Aneurinibacillus, Anoxy bacillus, Brevibacillus, Filobacillus, Gracilibacillus, Halobacillus, Paenibacillus, Salibacillus, Thermobacillus, Ureibacillus, and Virgibacillus.
- variant proteins differ from a parent protein and one another by a small number of amino acid residues.
- the number of differing amino acid residues may be one or more, preferably 1, 2, 3, 4, 5, 10, 15, 20, 30, 40, 50, or more amino acid residues.
- the number of different amino acids between variants is between 1 and 10.
- related proteins and particularly variant proteins comprise at least 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%. 95%, 97%, 98%, or 99% amino acid sequence identity.
- a related protein or a variant protein as used herein refers to a protein that differs from another related protein or a parent protein in the number of prominent regions.
- variant proteins have 1, 2, 3, 4, 5, or 10 corresponding prominent regions that differ from the parent protein.
- Several methods are known in the art that are suitable for generating variants of the enzymes of the present invention, including but not limited to site-saturation mutagenesis, scanning mutagenesis, insertional mutagenesis, random mutagenesis, site-directed mutagenesis, and directed-evolution, as well as various other recombinatorial approaches. Characterization of wild-type and mutant proteins is accomplished via any means or "test" suitable and is preferably based on the assessment of properties of interest.
- pH and/or temperature as well as detergent and /or oxidative stability is/are determined m some embodiments of the present invention. Indeed, it is contemplated that enzymes having various degrees of stability in one or more of these characteristics (pH, temperature, proteolytic stability, detergent stability, and/or oxidative stability) will find use.
- polynucleotide and “'nucleic acid”, used interchangeably herein, refer to a polymeric form of nucleotides of any length, either ribonucleotides or deoxyribonucleotides. These terms include, but are not limited to, a single-, double- or triple-stranded DNA, genomic DNA, cDNA, RNA, DNA-RNA hybrid, or a polymer comprising purine and pyrimidine bases, or other natural, chemically, biochemically modified, non-natural or derivatized nucleotide bases.
- polynucleotides genes, gene fragments, chromosomal fragments, ESTs, exons, introns, mRNA, tRNA, rRNA, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers.
- polynucleotides comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs, uracil, other sugars and linking groups such as fluororibose and thioate, and nucleotide branches.
- the sequence of nucleotides is interrupted by non-nucleotide components.
- DNA construct and “transforming DNA” are used interchangeably to refer to DNA used to introduce sequences into a host cell or organism. The DNA may be generated in vitro by PCR or any other suitable technique(s) known to those in the art.
- the DNA construct comprises a sequence of interest (e.g., as an incoming sequence).
- the sequence is operably linked to additional elements such as control elements (e.g., promoters, etc.).
- the DNA construct may further comprise a selectable marker. It may further comprise an incoming sequence flanked by homology boxes.
- the transforming DNA comprises other nonhomologous sequences, added to the ends (e.g., staffer sequences or flanks). In some embodiments, the ends of the incoming sequence are closed such that the transforming DNA forms a closed circle.
- the transforming sequences may be wild-type, mutant or modified.
- the DNA construct comprises sequences homologous to the host cell chromosome. In other embodiments, the DNA construct comprises non-homologous sequences.
- the DNA construct may be used to: 1) insert heterologous sequences into a desired target sequence of a host cell, and/or 2) mutagenize a region of the host cell chromosome (i.e., replace an endogenous sequence with a heterologous sequence), 3) delete target genes; and/or introduce a replicating plasmid into the host.
- expression cassette and "expression vector” refer to nucleic acid constructs generated recombinantly or synthetically, with a series of specified nucleic acid elements that permit transcription of a particular nucleic acid in a target cell.
- the recombinant expression cassette can be incorporated into a plasmid, chromosome, mitochondrial DNA, plastid DNA, virus, or nucleic acid fragment.
- the recombinant expression cassette portion of an expression vector includes, among other sequences, a nucleic acid sequence to be transcribed and a promoter.
- expression vectors have the ability to incorporate and express heterologous DNA fragments in a host cell.
- vectors refers to a polynucleotide construct designed to introduce nucleic acids into one or more cell types. Vectors include cloning vectors, expression vectors, shuttle vectors, plasmids, cassettes and the like.
- the polynucleotide construct comprises a DNA sequence encoding the protease (e.g., precursor or mature protease) that is operably linked to a suitable prosequence (e.g., secretory, etc.) capable of effecting the expression of the DNA in a suitable host.
- a suitable prosequence e.g., secretory, etc.
- plasmid refers to a circular double-stranded (ds) DNA construct used as a cloning vector, and which forms an extrachromosomal self -replicating genetic element in some eukaryotes or prokaryotes, or integrates into the host chromosome.
- the term "introduced” refers to any method suitable for transferring the nucleic acid sequence into the cell. Such methods for introduction include but are not limited to protoplast fusion, transfection, transformation, conjugation, and transduction (See e.g., Ferrari et al., “Genetics, " in Hardwood et al, (eds.), Bacillus, Plenum Publishing Corp., pages 57-72, 1989).
- the terms “transformed” and “stably transformed” refers to a cell that has a non-native (heterologous) polynucleotide sequence integrated into its genome or as an episomal plasmid that is maintained for at least two generations.
- selectable marker-encoding nucleotide sequence refers to a nucleotide sequence, which is capable of expression in the host cells and where expression of the selectable marker confers to cells containing the expressed gene the ability to grow in the presence of a corresponding selective agent or lack of an essential nutrient.
- selectable marker and “selective marker " ' refer to a nucleic acid (e.g., a gene) capable of expression m host cell, which allows for ease of selection of those hosts containing the vector. Examples of such selectable markers include but are not limited to antimicrobials.
- selectable marker refers to genes that provide an indication that a host cell has taken up an incoming DNA of interest or some other reaction has occurred.
- selectable markers are genes that confer antimicrobial resistance or a metabolic advantage on the host cell to allow cells containing the exogenous DNA to be distinguished from cells that have not received any exogenous sequence during the transformation.
- a "residing selectable marker” is one that is located on the chromosome of the microorganism to be transformed.
- a residing selectable marker encodes a gene that is different from the selectable marker on the transforming DNA construct. Selective markers are well known to those of skill in the art.
- the marker is an antimicrobial resistant marker (e.g., amp R ; phleo R ; spec R ; kan R ; ery 1 ⁇ ; tet R ; cmp R ; and neo R (See e.g., Guerot-Fleury, Gene, 167:335- 337, 1995; Palmeros et al, Gene 247:255-264, 2000; and Trieu-Cuot et al, Gene, 23:331-341, 1983).
- markers useful in accordance with the invention include, but are not limited to auxotrophic markers, such as tryptophan; and detection markers, such as ⁇ - galactosidase.
- promoter refers to a nucleic acid sequence that functions to direct transcription of a downstream gene.
- the promoter is appropriate to the host cell in which the target gene is being expressed.
- the promoter, together with other transcriptional and translational regulatory nucleic acid sequences (also termed “control sequences") is necessary to express a given gene.
- control sequences also termed “control sequences”
- the transcriptional and translational regulatory sequences include, but are not limited to, promoter sequences, nbosomal binding sites, transcriptional start and stop sequences, translational start and stop sequences, and enhancer or activator sequences.
- a nucleic acid is "operably linked" when it is placed into a functional relationship with another nucleic acid sequence.
- DNA encoding a secretory leader i.e., a signal peptide
- a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence
- a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation.
- operably linked means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading phase. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice.
- gene refers to a polynucleotide (e.g., a DNA segment) that encodes a polypeptide and includes regions preceding and following the coding regions as well as intervening sequences (introns) between individual coding segments (exons).
- homologous genes refers to a pair of genes from different, but usually related species, which correspond to each other and which are identical or very similar to each other.
- the term encompasses genes that are separated by speciation (i.e., the development of new species) (e.g., orthologous genes), as well as genes that have been separated by genetic duplication (e.g., paralogous genes).
- ortholog and “orthologous genes” refer to genes in different species that have evolved from a common ancestral gene (i.e., a homologous gene) by speciation. Typically, orthologs retain the same function during the course of evolution. Identification of orthologs finds use in the reliable prediction of gene function in newly sequenced genomes.
- paralogous genes refer to genes that are related by duplication within a genome. While orthologs retain the same function through the course of evolution, paralogs evolve new functions, even though some functions are often related to the original one. Examples of paralogous genes include, but are not limited to genes encoding trypsin, chymotrypsin, elastase, and thrombin, which are all serine proteinases and occur together within the same species.
- homology refers to sequence similarity or identity, with identity being preferred. This homology is determined using standard techniques known in the art (See e.g., Smith and Waterman, Adv Appl Math, 2:482, 1981; Needleman and Wunsch, J MoI Biol, 48:443, 1970; Pearson and Lipman, Proc Natl Acad Sci USA, 85:2444, 1988; programs such as GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, Madison, WI; and Devereux et al., Nucl Acid Res, 12:387-395, 1984).
- an "analogous sequence” is one wherein the function of the gene is essentially the same as the gene based on the B. amyloliquefaciens NprE protease. Additionally, analogous genes include at least about 45%, about 50%, about 55%, about 60%, about 65%, about 70%. about 75%, about 80%, about 85%, about 90%, about 95%, about 97%, about 98%, about 99%. or about 100% sequence identity with the sequence of the B. amyloliquefaciens NprE protease. In additional embodiments more than one of the above properties applies to the sequence. Analogous sequences are determined by known methods of sequence alignment. A commonly used alignment method is BLAST, although as indicated above and below, there are other methods that also find use in aligning sequences.
- PILEUP creates a multiple sequence alignment from a group of related sequences using progressive, pair-wise alignments. It can also plot a tree showing the clustering relationships used to create the alignment. PILEUP uses a simplification of the progressive alignment method of Feng and Doolittle (Feng and Doolittle, J MoI Evol, 35:351-360, 1987). The method is similar to that described by Higgins and Sharp (Higgins and Sharp, CABIOS 5:151-153, 1989).
- Useful PILEUP parameters including a default gap weight of 3.00, a default gap length weight of 0.10, and weighted end gaps.
- BLAST algorithm Another example of a useful algorithm is the BLAST algorithm, described by Altschul et al, (Altschul et al, J MoI Biol, 215:403-410, 1990; and Karlin et al, Proc Natl Acad Sci USA, 90:5873-5787, 1993).
- the HSP S and HSP S2 parameters are dynamic values and are established by the program itself depending upon the composition of the particular sequence and composition of the particular database against which the sequence of interest is being searched. However, the values may be adjusted to increase sensitivity.
- a % amino acid sequence identity value is determined by the number of matching identical residues divided by the total number of residues of the "longer" sequence in the aligned region. The "longer" sequence is the one having the most actual residues in the aligned region (gaps introduced by WU-B las t-2 to maximize the alignment score are ignored).
- percent (%) nucleic acid sequence identity is defined as the percentage of nucleotide residues in a candidate sequence that are identical to the nucleotide residues of the stalling sequence (i.e., the sequence of interest).
- a preferred method utilizes the BLASTN module of WU-BLAST-2 set to the default parameters, with overlap span and overlap fraction set to 1 and 0.125, respectively.
- hybridization refers to the process by which a strand of nucleic acid joins with a complementary strand through base pairing, as known in the art.
- a nucleic acid sequence is considered to be "selectively hybridizable" to a reference nucleic acid sequence if the two sequences specifically hybridize to one another under moderate to high stringency hybridization and wash conditions.
- Hybridization conditions are based on the melting temperature (Tm) of the nucleic acid binding complex or probe.
- Tm melting temperature
- maximum stringency typically occurs at about Tm-5°C (5° below the Tm of the probe); ''high stringency” at about 5-1O 0 C below the Tm; “intermediate stringency” at about 10-20 0 C below the Tm of the probe; and “low stringency” at about 20-25 0 C below the Tm.
- maximum stringency conditions may be used to identify sequences having strict identity or near-strict identity with the hybridization probe; while intermediate or low stringency hybridization can be used to identify or detect polynucleotide sequence homologs.
- Moderate and high stringency hybridization conditions are well known in the art.
- An example of high stringency conditions includes hybridization at about 42°C in 50% formamide, 5X SSC, 5X Denhardt's solution, 0.5% SDS and 100 ⁇ g/ml denatured carrier DNA followed by washing two times in 2X SSC and 0.5% SDS at room temperature and two additional times in 0. IX SSC and 0.5% SDS at 42 0 C.
- moderate stringent conditions include an overnight incubation at 37 0 C in a solution comprising 20% formamide, 5 x SSC (15OmM NaCl, 15 mM trisodium citrate), 50 mM sodium phosphate (pH 7.6), 5 x Denhardt's solution, 10% dextran sulfate and 20 mg/ml denatured sheared salmon sperm DNA, followed by washing the filters in Ix SSC at about 37 - 5O 0 C.
- Those of skill in the art know how to adjust the temperature, ionic strength, etc. as necessary to accommodate factors such as probe length and the like.
- recombinant includes reference to a cell or vector, that has been modified by the introduction of a heterologous nucleic acid sequence or that the cell is derived from a cell so modified.
- recombinant cells express genes that are not found in identical form within the native (non-recombinant) form of the cell or express native genes that are otherwise abnormally expressed, under expressed or not expressed at all as a result of deliberate human intervention.
- “Recombination,” “recombining,” and generating a “recombined” nucleic acid are generally the assembly of two or more nucleic acid fragments wherein the assembly gives rise to a chimeric gene.
- mutant DNA sequences are generated with site saturation mutagenesis in at least one codon. In another preferred embodiment, site saturation mutagenesis is performed for two or more codons. In a further embodiment, mutant DNA sequences have more than about 50%, more than about 55%, more than about 60%, more than about 65%, more than about 70%, more than about 75%, more than about 80%, more than about 85%, more than about 90%. more than about 95%, or more than about 98% homology with the wild-type sequence. In alternative embodiments, mutant DNA is generated in vivo using any known mutagenic procedure such as, for example, radiation, nitrosoguanidine and the like. The desired DNA sequence is then isolated and used in the methods provided herein.
- target sequence refers to a DNA sequence in the host cell that encodes the sequence where it is desired for the incoming sequence to be inserted into the host cell genome.
- the target sequence encodes a functional wild-type gene or operon, while in other embodiments the target sequence encodes a functional mutant gene or operon, or a non-functional gene or operon.
- a "flanking sequence” refers to any sequence that is either upstream or downstream of the sequence being discussed (e.g., for genes A-B-C, gene B is flanked by the A and C gene sequences).
- the incoming sequence is flanked by a homology box on each side.
- the incoming sequence and the homology boxes comprise a unit that is flanked by stuffer sequence on each side.
- a flanking sequence is present on only a single side (either 3' or 5'), but in preferred embodiments, it is on each side of the sequence being flanked. In some embodiments, a flanking sequence is present on only a single side (either 3' or 5').
- stuffer sequence refers to any extra DNA that flanks homology boxes (typically vector sequences). However, the term encompasses any nonhomologous DNA sequence. Not to be limited by any theory, a stuffer sequence provides a noncritical target for a cell to initiate DNA uptake.
- amplification and “gene amplification” refer to a process by which specific DNA sequences are disproportionately replicated such that the amplified gene becomes present in a higher copy number than was initially present in the genome.
- selection of cells by growth in the presence of a drug results in the amplification of either the endogenous gene encoding the gene product required for growth in the presence of the drug or by amplification of exogenous (i.e., input) sequences encoding this gene product, or both.
- Amplification is a special case of nucleic acid replication involving template specificity. It is to be contrasted with non-specific template replication (i.e., replication that is template-dependent but not dependent on a specific template). Template specificity is here distinguished from fidelity of replication (i.e., synthesis of the proper polynucleotide sequence) and nucleotide (ribo- or deoxyribo-) specificity. Template specificity is frequently described in terms of “target” specificity. Target sequences are “targets” in the sense that they are sought to be sorted out from other nucleic acid. Amplification techniques have been designed primarily for this sorting out.
- the term "co-amplification” refers to the introduction into a single cell of an amplifiable marker m conjunction with other gene sequences (i.e., comprising one or more non-selectable genes such as those contained within an expression vector) and the application of appropriate selective pressure such that the cell amplifies both the amplifiable marker and the other, non-selectable gene sequences.
- the amplifiable marker may be physically linked to the other gene sequences or alternatively two separate pieces of DNA, one containing the amplifiable marker and the other containing the non-selectable marker, may be introduced into the same cell.
- amplifiable marker As used herein, the terms "amplifiable marker,” “amplifiable gene.” and “amplification vector” refer to a gene or a vector encoding a gene, which permits the amplification of that gene under appropriate growth conditions.
- Tempor specificity is achieved in most amplification techniques by the choice of enzyme.
- Amplification enzymes are enzymes that, under conditions they are used, will process only specific sequences of nucleic acid in a heterogeneous mixture of nucleic acid.
- MDV-I RNA is the specific template for the replicase (See e.g., Kacian et al. , Proc Natl Acad Sci USA 69:3038, 1972) and other nucleic acids are not replicated by this amplification enzyme.
- this amplification enzyme has a stringent specificity for its own promoters (See, Chamberlin et al , Nature 228:227, 1970).
- the enzyme will not ligate the two oligonucleotides or polynucleotides, where there is a mismatch between the oligonucleotide or polynucleotide substrate and the template at the ligation junction (See, Wu and Wallace, Genomics 4:560, 1989).
- Taq and Pf u polymerases by ⁇ irtue of their ability to function at high temperature, are found to display high specificity for the sequences bounded and thus defined by the primers; the high temperature results in thermodynamic conditions that favor primer hybridization with the target sequences and not hybridization with non-target sequences.
- the term "amplifiable nucleic acid” refers to nucleic acids, which may be amplified by any amplification method. It is contemplated that "amplifiable nucleic acid” will usually comprise "sample template.”
- sample template refers to nucleic acid originating from a sample, which is analyzed for the presence of "target” (defined below).
- background template is used in reference to nucleic acid other than sample template, which may or may not be present in a sample. Background template is most often inadvertent. It may be the result of carryover, or it may be due to the presence of nucleic acid contaminants sought to be purified away from the sample. For example, nucleic acids from organisms other than those to be detected may be present as background in a test sample.
- the term "primer” refers to an oligonucleotide, whether occurring naturally as in a purified restriction digest or produced synthetically, which is capable of acting as a point of initiation of synthesis when placed under conditions in which synthesis of a primer extension product which is complementary to a nucleic acid strand is induced, (i.e., in the presence of nucleotides and an inducing agent such as DNA polymerase and at a suitable temperature and pH).
- the primer is preferably single stranded for maximum efficiency in amplification, but may alternatively be double stranded. If double stranded, the primer is first treated to separate its strands before being used to prepare extension products.
- the primer is an oligodeoxyribonucleotide.
- the primer must be sufficiently long to prime the synthesis of extension products in the presence of the inducing agent. The exact lengths of the primers will depend on many factors, including temperature, source of primer and the use of the method.
- probe refers to an oligonucleotide (i.e., a sequence of nucleotides), whether occurring naturally as m a purified restriction digest or produced synthetically, recombinantly or by PCR amplification, which is capable of hybridizing to another oligonucleotide of interest.
- a probe may be single-stranded or double-stranded. Probes are useful in the detection, identification and isolation of particular gene sequences. It is contemplated that any probe used in the present invention will be labeled with any "reporter molecule,” so that is detectable in any detection system, including, but not limited to enzyme (e.g., ELISA. as well as enzyme-based histochemical assays), fluorescent, radioactive, and luminescent systems. It is not intended that the present invention be limited to any particular detection system or label.
- target when used in reference to the polymerase chain reaction, refers to the region of nucleic acid bounded by the primers used for polymerase chain reaction. Thus, the “target” is sought to be sorted out from other nucleic acid sequences.
- a “segment” is defined as a region of nucleic acid within the target sequence.
- PCR polymerase chain reaction
- the mixture is denatured and the primers then annealed to their complementary sequences within the target molecule.
- the primers are extended with a polymerase so as to form a new pair of complementary strands.
- the steps of denaturation, primer annealing and polymerase extension can be repeated many times (i.e., denaturation, annealing and extension constitute one "cycle”; there can be numerous "cycles") to obtain a high concentration of an amplified segment of the desired target sequence.
- the length of the amplified segment of the desired target sequence is determined by the relative positions of the primers with respect to each other, and therefore, this length is a controllable parameter.
- PCR polymerase chain reaction
- amplification reagents refers to those reagents (deoxyribonucleotide triphosphates, buffer, etc.), needed for amplification except for primers, nucleic acid template and the amplification enzyme.
- amplification reagents along with other reaction components are placed and contained m a reaction vessel (test tube, microwell, etc.).
- PCR it is possible to amplify a single copy of a specific target sequence in genomic DNA to a level detectable by several different methodologies (e.g., hybridization with a labeled probe; incorporation of biotinylated primers followed by avidin-enzyme conjugate detection; incorporation of P-labeled deoxynucleotide triphosphates, such as dCTP or dATP, into the amplified segment).
- any oligonucleotide or polynucleotide sequence can be amplified with the appropriate set of primer molecules.
- the amplified segments created by the PCR process itself are, themselves, efficient templates for subsequent PCR amplifications.
- PCR product refers to the resultant mixture of compounds after two or more cycles of the PCR steps of denaturation, annealing and extension are complete. These terms encompass the case where there has been amplification of one or more segments of one or more target sequences.
- RT-PCR refers to the replication and amplification of RNA sequences.
- reverse transcription is coupled to PCR, most often using a one enzyme procedure in which a thermostable polymerase is employed, as described in U.S. Patent No. 5,322,770, herein incorporated by reference.
- the RNA template is converted to cDNA due to the reverse transcriptase activity of the polymerase, and then amplified using the polymerizing activity of the polymerase (i.e., as in other PCR methods).
- the terms “restriction endonucleases” and “restriction enzymes” refer to bacterial enzymes, each of which cut double-stranded DNA at or near a specific nucleotide sequence.
- restriction site refers to a nucleotide sequence recognized and cleaved by a given restriction endonuclease and is frequently the site for insertion of DNA fragments.
- restriction sites are engineered into the selective marker and into 5' and 3' ends of the DNA construct.
- chromosomal integration refers to the process whereby an incoming sequence is introduced into the chromosome of a host cell.
- the homologous regions of the transforming DNA align with homologous regions of the chromosome. Subsequently, the sequence between the homology boxes is replaced by the incoming sequence in a double crossover (i.e., homologous recombination).
- homologous sections of an inactivating chromosomal segment of a DNA construct align with the flanking homologous regions of the indigenous chromosomal region of the Bacillus chromosome. Subsequently, the indigenous chromosomal region is deleted by the DNA construct in a double crossover (i.e., homologous recombination).
- homologous recombination means the exchange of DNA fragments between two DNA molecules or paired chromosomes at the site of identical or nearly identical nucleotide sequences.
- chromosomal integration is homologous recombination.
- homologous sequences as used herein means a nucleic acid or polypeptide sequence having about 100%, about 99%, about 98%, about 97%, about 96%, about 95%, about 94%, about 93%. about 92%, about 91%, about 90%, about 88%, about 85%, about 80%, about 75%, or about 70% sequence identity to another nucleic acid or polypeptide sequence when optimally aligned for comparison.
- homologous sequences have between about 85% and about 100% sequence identity, while in other embodiments there is between about 90% and about 100% sequence identity, and in more preferred embodiments, there is about 95% and about 100% sequence identity.
- amino acid refers to peptide or protein sequences or portions thereof.
- protein protein
- peptide and polypeptide
- heterologous protein refers to a protein or polypeptide that does not naturally occur in the host cell. Examples of heterologous proteins include enzymes such as hydrolases including proteases.
- the gene encoding the proteins are naturally occurring genes, while in other embodiments, mutated and/or synthetic genes are used.
- homologous protein refers to a protein or polypeptide native or naturally occurring in a cell.
- the cell is a Gram-positive cell, while in particularly preferred embodiments the cell is a Bacillus host cell.
- the homologous protein is a native protein produced by other organisms, including but not limited to E. coli, Streptomyces, Trichoderma, wad Aspergillus.
- the invention encompasses host cells producing the homologous protein via recombinant DNA technology.
- an "operon region” comprises a group of contiguous genes that are transcribed as a single transcription unit from a common promoter, and are thereby subject to co- regulation.
- the operon includes a regulator gene.
- operons that are highly expressed as measured by RNA levels, but have an unknown or unnecessary function are used.
- an "antimicrobial region” is a region containing at least one gene that encodes an antimicrobial protein.
- a polynucleotide is said to "encode" an RNA or a polypeptide if, in its native state or when manipulated by methods known to those of skill in the art, it can be transcribed and/or translated to produce the RNA, the polypeptide or a fragment thereof.
- the anti-sense strand of such a nucleic acid is also said to encode the sequences.
- RNA can be transcribed by an RNA polymerase to produce RNA, but an RNA can be reverse transcribed by reverse transcriptase to produce a DNA.
- a DNA can encode a RNA and vice versa.
- regulatory segment or “regulatory sequence” or “expression control sequence” refers to a polynucleotide sequence of DNA that is operatively linked with a polynucleotide sequence of DNA that encodes the amino acid sequence of a polypeptide chain to effect the expression of the encoded amino acid sequence.
- the regulatory sequence can inhibit, repress, or promote the expression of the operably linked polynucleotide sequence encoding the amino acid.
- “Host strain” or “host cell” refers to a suitable host for an expression vector comprising DNA according to the present invention.
- An enzyme is "overexpressed" in a host cell if the enzyme is expressed in the cell at a higher level that the level at which it is expressed in a corresponding wild-type cell.
- polypeptide proteins and polypeptide are used interchangeability herein.
- the 3-letter code for amino acids as defined in conformity with the IUPAC-IUB Joint Commission on Biochemical Nomenclature (JCBN) is used through out this disclosure. It is also understood that a polypeptide may be coded for by more than one nucleotide sequence due to the degeneracy of the genetic code.
- a "prosequence” is an amino acid sequence between the signal sequence and mature protease that is necessary for the secretion of the protease. Cleavage of the pro sequence will result in a mature active protease.
- signal sequence refers to any sequence of nucleotides and/or amino acids that participate in the secretion of the mature or precursor forms of the protein.
- This definition of signal sequence is a functional one, meant to include all those amino acid sequences encoded by the N-terminal portion of the protein gene, which participate in the effectuation of the secretion of protein. They are often, but not universally, bound to the N- terminal portion of a protein or to the N-terminal portion of a precursor protein.
- the signal sequence may be endogenous or exogenous.
- the signal sequence may be that normally associated with the protein (e.g., protease), or may be from a gene encoding another secreted protein.
- One exemplary exogenous signal sequence comprises the first seven amino acid residues of the signal sequence from Bacillus subtilis subtihsin fused to the remainder of the signal sequence of the subtilisin from Bacillus lentus (ATCC 21536).
- hybrid signal sequence refers to signal sequences in which part of sequence is obtained from the expression host fused to the signal sequence of the gene to be expressed. In some embodiments, synthetic sequences are utilized.
- mature form of a protein or peptide refers to the final functional form of the protein or peptide. To exemply, a mature form of the NprE protease of the present invention at least includes the ammo acid sequence of SEQ ID NO:3.
- precursor form of a protein or peptide refers to a mature form of the protein having a prosequence operably linked to the amino or carbonyl terminus of the protein.
- the precursor may also have a "signal" sequence operably linked, to the amino terminus of the prosequence.
- the precursor may also have additional polynucleotides that are involved in post- translational activity (e.g., polynucleotides cleaved therefrom to leave the mature form of a protein or peptide).
- Naturally occurring enzyme refers to an enzyme having the unmodified amino acid sequence identical to that found in nature.
- Naturally occurring enzymes include native enzymes, those enzymes naturally expressed or found in the particular microorganism.
- protease derived from or producible by a strain of the organism in question, but also a protease encoded by a DNA sequence isolated from such strain and produced in a host organism containing such DNA sequence. Additionally, the term refers to a protease that is encoded by a DNA sequence of synthetic and/or cDNA origin and which has the identifying characteristics of the protease in question.
- protease that is encoded by a DNA sequence of synthetic and/or cDNA origin and which has the identifying characteristics of the protease in question.
- proteases derived from Bacillus sp. refers to those enzymes having proteolytic activity which are naturally-produced by Bacillus sp. , as well as to neutral metalloproteases like those produced by Bacillus sp. sources but which through the use of genetic engineering techniques are produced by non-Bacillus amyloliquefaciens organisms transformed with a nucleic acid encoding said neutral metalloproteases.
- a “derivative" within the scope of this definition generally retains the characteristic proteolytic activity observed in the wild-type, native or parent form to the extent that the derivative is useful for similar purposes as the wild-type, native or parent form.
- Functional derivatives of neutral metalloprotease encompass naturally occurring, synthetically or recombinantly produced peptides or peptide fragments having the general characteristics of the neutral metalloprotease of the present invention.
- the term "functional derivative” refers to a derivative of a nucleic acid having the functional characteristics of a nucleic acid encoding a neutral metalloprotease.
- Functional derivatives of a nucleic acid, which encode neutral metalloprotease of the present invention encompass naturally occurring, synthetically or recombinantly produced nucleic acids or fragments and encode neutral metalloprotease characteristic of the present invention.
- Wild type nucleic acid encoding neutral metalloprotease according to the invention include naturally occurring alleles and homologies based on the degeneracy of the genetic code known in the art.
- nucleic acid or polypeptide sequences refers to the residues in the two sequences that are the same when aligned for maximum correspondence, as measured using one of the following sequence comparison or analysis algorithms.
- sequence comparison or analysis algorithms refers to the alignment giving the highest percent identity score.
- Percent sequence identity refers to the percentage of residues that are identical in the two sequences when the sequences are optimally aligned.
- 80% amino acid sequence identity means that 80% of the amino acids in two optimally aligned polypeptide sequences are identical.
- substantially identical in the context of two nucleic acids or polypeptides thus refers to a polynucleotide or polypeptide that comprising at least about 70% sequence identity, preferably at least about 75%, preferably at least about 80%, preferably at least about 85%, preferably at least about 90%, preferably at least about 95%, preferably at least about 97% , preferably at least about 98%, and preferably at least about 99% sequence identity as compared to a reference sequence using the programs or algorithms (e.g., BLAST, ALIGN, CLUSTAL) using standard parameters.
- One indication that two polypeptides are substantially identical is that the first polypeptide is immunologically cross-reactive with the second polypeptide.
- polypeptides that differ by conservative amino acid substitutions are immunologically cross- reactive.
- a polypeptide is substantially identical to a second polypeptide, for example, where the two peptides differ only by a conservative substitution.
- Another indication that two nucleic acid sequences are substantially identical is that the two molecules hybridize to each other under stringent conditions (e.g., within a range of medium to high stringency).
- isolated refers to a material that is removed from its original environment (e.g., the natural environment if it is naturally occurring).
- the material is said to be “purified” when it is present in a particular composition in a higher or lower concentration than exists in a naturally occurring or wild type organism or in combination with components not normally present upon expression from a naturally occurring or wild type organism.
- a naturally-occurring polynucleotide or polypeptide present in a living animal is not isolated, but the same polynucleotide or polypeptide, separated from some or all of the coexisting materials in the natural system, is isolated.
- Such polynucleotides could be part of a vector, and/or such polynucleotides or polypeptides could be part of a composition, and still be isolated in that such vector or composition is not part of its natural environment.
- a nucleic acid or protein is said to be purified, for example, if it gives rise to essentially one band in an electrophoretic gel or blot.
- isolated when used in reference to a DNA sequence, refers to a DNA sequence that has been removed from its natural genetic milieu and is thus free of other extraneous or unwanted coding sequences, and is in a form suitable for use within genetically engineered protein production systems. Such isolated molecules are those that are separated from their natural environment and include cDNA and genomic clones. Isolated DNA molecules of the present invention are free of other genes with which they are ordinarily associated, but may include naturally occurring 5' and 3' untranslated regions such as promoters and terminators. The identification of associated regions will be evident to one of ordinary skill in the art (See e.g., Dynan and Tijan, Nature 316:774-78, 1985).
- an isolated DNA sequence is alternatively referred to as "a cloned DNA sequence".
- isolated when used in reference to a protein, refers to a protein that is found in a condition other than its native environment. In a preferred form, the isolated protein is substantially free of other proteins, particularly other homologous proteins.
- An isolated protein is more than about 10% pure, preferably more than about 20% pure, and even more preferably more than about 30% pure, as determined by SDS-PAGE.
- Further aspects of the invention encompass the protein in a highly purified form (i.e., more than about 40% pure, more than about 60% pure, more than about 80% pure, more than about 90% pure, more than about 95% pure, more than about 97% pure, and even more than about 99% pure), as determined by SDS-PAGE.
- cassette mutagenesis method may be used to facilitate the construction of the enzyme variants of the present invention, although other methods may be used.
- a naturally-occurring gene encoding the enzyme is obtained and sequenced in whole or in part. Then, the sequence is scanned for a point at which it is desired to make a mutation (deletion, insertion or substitution) of one or more amino acids in the encoded enzyme. The sequences flanking this point are evaluated for the presence of restriction sites for replacing a short segment of the gene with an oligonucleotide pool which when expressed will encode various mutants. Such restriction sites are preferably unique sites within the protein gene so as to facilitate the replacement of the gene segment.
- any convenient restriction site that is not overly redundant in the enzyme gene may be used, provided the gene fragments generated by restriction digestion can be reassembled m proper sequence. If restriction sites are not present at locations within a convenient distance from the selected point (from 10 to 15 nucleotides), such sites are generated by substituting nucleotides m the gene in such a fashion that neither the reading frame nor the amino acids encoded are changed m the final construction. Mutation of the gene in order to change its sequence to conform to the desired sequence is accomplished by Ml 3 primer extension in accord with generally known methods.
- flanking regions are made routine by the redundancy of the genetic code, a restriction enzyme map of the gene and the large number of different restriction enzymes. Note that if a convenient flanking restriction site is available, the above method need be used only in connection with the flanking region that does not contain a site.
- the restriction sites flanking the positions to be mutated are digested with the cognate restriction enzymes and a plurality of end termini-complementary oligonucleotide cassettes are ligated into the gene.
- the mutagenesis is simplified by this method because all of the oligonucleotides can be synthesized so as to have the same restriction sites, and no synthetic linkers are necessary to create the restriction sites.
- corresponding to refers to a residue at the enumerated position in a protein or peptide, or a residue that is analogous, homologous, or equivalent to an enumerated residue in a protein or peptide.
- corresponding region generally refers to an analogous position along related proteins or a parent protein.
- combinatorial mutagenesis refers to methods in which libraries of variants of a starting sequence are generated.
- the variants contain one or several mutations chosen from a predefined set of mutations.
- the methods provide means to introduce random mutations, which were not members of the predefined set of mutations.
- the methods include those set forth in U.S. Application No. 09/699,250, filed October 26, 2000, hereby incorporated by reference.
- combinatorial mutagenesis methods encompass commercially available kits (e.g., QUIKCHANGE® Multisite, Stratagene, San Diego, CA).
- library of mutants refers to a population of cells which are identical in most of their genome but include different homologues of one or more genes. Such libraries can be used, for example, to identify genes or operons with improved traits.
- starting gene and “parent gene” refer to a gene of interest that encodes a protein of interest that is to be improved and/or changed using the present invention.
- multiple sequence alignment and “MSA” refer to the sequences of multiple homologs of a starting gene that are aligned using an algorithm (e.g., Clustal W).
- the terms "consensus sequence” and “canonical sequence” refer to an archetypical amino acid sequence against which all variants of a particular protein or sequence of interest are compared. The terms also refer to a sequence that sets forth the nucleotides that are most often present in a DNA sequence of interest. For each position of a gene, the consensus sequence gives the amino acid that is most abundant in that position in the MSA.
- Consensus mutation refers to a difference in the sequence of a stalling gene and a consensus sequence. Consensus mutations are identified by comparing the sequences of the starting gene and the consensus sequence obtained from a MSA. In some embodiments, consensus mutations are introduced into the starting gene such that it becomes more similar to the consensus sequence. Consensus mutations also include amino acid changes that change an amino acid in a starting gene to an amino acid that is more frequently found in an MSA at that position relative to the frequency of that amino acid in the starting gene. Thus, the term consensus mutation comprises all single amino acid changes that replace an amino acid of the starting gene with an amino acid that is more abundant than the amino acid in the MSA.
- modified sequence and ''modified genes are used interchangeably herein to refer to a sequence that includes a deletion, insertion or interruption of naturally occurring nucleic acid sequence.
- the expression product of the modified sequence is a truncated protein (e.g., if the modification is a deletion or interruption of the sequence).
- the truncated protein retains biological activity.
- the expression product of the modified sequence is an elongated protein (e.g., modifications comprising an insertion into the nucleic acid sequence).
- an insertion leads to a truncated protein (e.g., when the insertion results in the formation of a stop codon).
- an insertion may result in either a truncated protein or an elongated protein as an expression product.
- mutant sequence and “mutant gene” are used interchangeably and refer to a sequence that has an alteration in at least one codon occurring in a host cell's wild- type sequence.
- the expression product of the mutant sequence is a protein with an altered amino acid sequence relative to the wild-type.
- the expression product may have an altered functional capacity (e.g., enhanced enzymatic activity).
- mutagenic primer or “mutagenic oligonucleotide” (used interchangeably herein) are intended to refer to oligonucleotide compositions which correspond to a portion of the template sequence and which are capable of hybridizing thereto. With respect to mutagenic primers, the primer will not precisely match the template nucleic acid, the mismatch or mismatches in the primer being used to introduce the desired mutation into the nucleic acid library.
- non-mutagenic primer or “non-mutagenic oligonucleotide” refers to oligonucleotide compositions that match precisely to the template nucleic acid. In one embodiment of the invention, only mutagenic primers are used.
- the primers are designed so that for at least one region at which a mutagenic primer has been included, there is also non-mutagenic primer included in the oligonucleotide mixture.
- a mixture of mutagenic primers and non-mutagenic primers corresponding to at least one of the mutagenic primers it is possible to produce a resulting nucleic acid library in which a variety of combinatorial mutational patterns are presented. For example, if it is desired that some of the members of the mutant nucleic acid library retain their parent sequence at certain positions while other members are mutant at such sites, the non-mutagenic primers provide the ability to obtain a specific level of non-mutant members within the nucleic acid library for a given residue.
- the methods of the invention employ mutagenic and non-mutagenic oligonucleotides which are generally between 10-50 bases in length, more preferably about 15-45 bases in length. However, it may be necessary to use primers that are either shorter than 10 bases or longer than 50 bases to obtain the mutagenesis result desired. With respect to corresponding mutagenic and non-mutagenic primers, it is not necessary that the corresponding oligonucleotides be of identical length, but only that there is overlap in the region corresponding to the mutation to be added. Primers may be added in a pre-defined ratio according to the present invention.
- the resulting library have a significant level of a certain specific mutation and a lesser amount of a different mutation at the same or different site
- by adjusting the amount of primer added it is possible to produce the desired biased library.
- by adding lesser or greater amounts of non-mutagenic primers it is possible to adjust the frequency with which the corresponding mutation(s) are produced in the mutant nucleic acid library.
- wild-type sequence refers to a sequence that is native or naturally occurring in a host cell.
- the wild-type sequence refers to a sequence of interest that is the starting point of a protein- engineering project.
- the wild-type sequence may encode either a homologous or heterologous protein.
- a homologous protein is one the host cell would produce without intervention.
- a heterologous protein is one that the host cell would not produce but for the intervention.
- oxidation stable refers to proteases of the present invention that retain a specified amount of enzymatic activity over a given period of time under conditions prevailing during the proteolytic, hydrolyzing, cleaning or other process of the invention, for example while exposed to or contacted with bleaching agents or oxidizing agents.
- the proteases retain at least about 50%, about 60%, about 70%, about 75%, about 80%, about 85%, about 90%. about 92%, about 95%, about 96%, about 97%, about 98%, or about 99% proteolytic activity after contact with a bleaching or oxidizing agent over a given time period, for example, at least 1 minute, 3 minutes, 5 minutes, 8 minutes, 12 minutes, 16 minutes, 20 minutes, etc.
- chelator stable refers to proteases of the present invention that retain a specified amount of enzymatic activity over a given period of time under conditions prevailing during the proteolytic, hydrolyzing, cleaning or other process of the invention, for example while exposed to or contacted with chelating agents.
- the proteases retain at least about 50%. about 60%, about 70%, about 75%, about 80%, about 85%, about 90%, about 92%, about 95%. about 96%, about 97%, about 98% or about 99% proteolytic activity after contact with a chelating agent over a given time period, for example, at least 10 minutes. 20 minutes, 40 minutes, 60 minutes, 100 minutes, etc.
- thermally stable and “thermostable” refer to proteases of the present invention that retain a specified amount of enzymatic activity after exposure to identified temperatures over a given period of time under conditions pre ⁇ ailing during the proteolytic, hydrolyzmg, cleaning or other process of the invention, for example while exposed altered temperatures. Altered temperatures include increased or decreased temperatures.
- the proteases retain at least about 50%, about 60%, about 70%, about 75%, about 80%, about 85%, about 90%, about 92%, about 95%, about 96%, about 97%, about 98%, or about 99% proteolytic activity after exposure to altered temperatures over a given time period, for example, at least 60 minutes, 120 minutes, 180 minutes, 240 minutes, 300 minutes, etc.
- the term "chemical stability” refers to the stability of a protein (e.g., an enzyme) towards chemicals that adversely affect its acti ⁇ ity.
- chemicals include, but are not limited to hydrogen peroxide, peracids, anionic detergents, cationic detergents, non-ionic detergents, chelants, etc.
- the terms "detergent stable” and “LAS stable” refer to proteases of the present invention that retain a specified amount of enzymatic activity after exposure to a detergent composition over a given period of time under conditions prevailing during the proteolytic, hydrolyzmg, cleaning or other process of the invention.
- the proteases retain at least about 50%, about 60%, about 70%, about 75%, about 80%, about 85%, about 90%, about 92%. about 95%, about 96%, about 97%, about 98%,or about 99% proteolytic activity after exposure to detergent over a given time period, for example, at least 60 minutes, 120 minutes, 180 minutes, 240 minutes, 300 minutes, etc.
- enhanced stability in the context of an oxidation, chelator, thermal and/or pH stable protease refers to a higher retained proteolytic activity over time as compared to other neutral metalloproteases and/or wild-type enzymes.
- diminished stability m the context of an oxidation, chelator, thermal and/or pH stable protease refers to a lower retained proteolytic activity over time as compared to other neutral metalloproteases and/or wild-type enzymes.
- cleaning composition includes, unless otherwise indicated, granular or powder-form all-purpose or "heavy-duty” washing agents, especially cleaning detergents; liquid, gel or paste-form all-purpose washing agents, especially the so-called heavy- duty liquid types; liquid fine-fabric detergents; hand dishwashing agents or light duty dishwashing agents, especially those of the high-foaming type; machine dishwashing agents, including the various tablet, granular, liquid and rinse-aid types for household and institutional use; liquid cleaning and disinfecting agents, including antibacterial hand-wash types, cleaning bars, mouthwashes, denture cleaners, car or carpet shampoos, bathroom cleaners; hair shampoos and hair-rinses; shower gels and foam baths and metal cleaners; as well as cleaning auxiliaries such as bleach additives and "stam-stick" or pre-treat types.
- all component or composition levels are in reference to the active level of that component or composition, and are exclusive of impurities, for example, residual solvents or by-product
- Enzyme components weights are based on total active protein. All percentages and ratios are calculated by weight unless otherwise indicated. All percentages and ratios are calculated based on the total composition unless otherwise indicated.
- cleaning activity refers to the cleaning performance achieved by the protease under conditions prevailing during the proteolytic, hydrolyzing, cleaning or other process of the invention.
- cleaning performance is determined by the application of various cleaning assays concerning enzyme sensitive stains, for example grass, blood, milk, or egg protein as determined by various chromatographic, spectrophotometric or other quantitative methodologies after subjection of the stams to standard wash conditions.
- Exemplary assays include, but are not limited to those described in WO 99/34011, and U.S. Patent No. 6,605,458 (both of which are herein incorporated by reference), as well as those methods included in the Examples.
- cleaning effective amount of a protease refers to the quantity of protease described hereinbefore that achieves a desired level of enzymatic activity in a specific cleaning composition. Such effective amounts are readily ascertained by one of ordinary skill in the art and are based on many factors, such as the particular protease used, the cleaning application, the specific composition of the cleaning composition, and whether a liquid or dry (e.g., granular, bar) composition is required, etc.
- cleaning adjunct materials means any liquid, solid or gaseous material selected for the particular type of cleaning composition desired and the form of the product (e.g., liquid, granule, powder, bar, paste, spray, tablet, gel; or foam composition), which materials are also preferably compatible with the protease enzyme used in the composition.
- granular compositions are in "compact” form, while in other embodiments, the liquid compositions are in a "concentrated” form.
- a "low detergent concentration" system includes detergents where less than about 800 ppm of detergent components are present in the wash water.
- Japanese detergents are typically considered low detergent concentration systems, as they have usually have approximately 667 ppm of detergent components present in the wash water.
- a "medium detergent concentration” systems includes detergents wherein between about 800 ppm and about 2000ppm of detergent components are present in the wash water.
- North American detergents are generally considered to be medium detergent concentration systems as they have usually approximately 975 ppm of detergent components present in the wash water.
- Brazilian detergents typically have approximately 1500 ppm of detergent components present in the wash water.
- high detergent concentration systems includes detergents wherein greater than about 2000 ppm of detergent components are present in the wash water.
- European detergents are generally considered to be high detergent concentration systems as they have approximately 3000-8000 ppm of detergent components in the wash water.
- fabric cleaning compositions include hand and machine laundry detergent compositions including laundry additive compositions and compositions suitable for use in the soaking and/or pretreatment of stained fabrics (e.g., clothes, linens, and other textile materials).
- non-fabric cleaning compositions include non-textile (i.e., fabric) surface cleaning compositions, including but not limited to dishwashing detergent compositions, oral cleaning compositions, denture cleaning compositions, and personal cleansing compositions.
- the "compact" form of the cleaning compositions herein is best reflected by density and, in terms of composition, by the amount of inorganic filler salt.
- Inorganic filler salts are conventional ingredients of detergent compositions in powder form. In conventional detergent compositions, the filler salts are present in substantial amounts, typically 17-35% by weight of the total composition. In contrast, in compact compositions, the filler salt is present in amounts not exceeding 15% of the total composition. In some embodiments, the filler salt is present in amounts that do not exceed 10%.
- the inorganic filler salts are selected from the alkali and alkaline-earth-metal salts of sulfates and chlorides.
- a preferred filler salt is sodium sulfate.
- Neutral metalloendopeptidases i.e., neutral metalloproteases (EC 3.4.24.4) belong to a protease class that has an absolute requirement for zinc ions for catalytic activity. These enzymes are optimally active at neutral pH and are in the 30 to 40 kDa size range.
- Neutral metalloproteases bind between two and four calcium ions that contribute to the structural stability of the protein. The bound metal ion at the active site of metalloproteases is an essential feature that allows the activation of a water molecule. The water molecule then functions as the nucleophile and cleaves the carbonyl group of the peptide bond.
- the neutral zinc -binding metalloprotease family includes the bacterial enzyme thermolysin, and thermolysin-like proteases ("TLPs' ' ), as well as carboxypeptidase A (a digestive enzyme), and the matrix metalloproteases that catalyze the reactions in tissue remodeling and degradation.
- TLPs' ' thermolysin-like proteases
- carboxypeptidase A a digestive enzyme
- TLPs thermolysin and its variants
- much research has been focused on the engineering Bacillus subtilis neutral proteases to increase the thermal stability of the enzyme (See e.g., Vriend et ah, In, Tweel et a (eds), Stability and Stabilization of enzymes, Elsevier, pp. 93- 99 [1993]).
- compositions and methods to engineer neutral metalloproteases with improved characteristics are provided herein.
- calcium ions have been reported for other proteases such as thermolysin to prevent autolysis.
- the B. stearothermophilus neutral protease has been stabilized against autolysis and proteolytic degradation by addition of calcium (See, Durrschmidt et ah, FEBS J., 272:1523-1534 [2005]).
- engineering prevents the local unfolding in a particular secondary structural element that may prevent proteolysis.
- subtilisin Natural and engineered proteases, such as subtilisin are often expressed in Bacillus subtilis and several have been applied in detergent formulations to remove proteinaceous stains. Others have been applied for example in the baking industry (e.g., thermolysin from Bacillus thermoproteolyticus; See e.g., Galante and Formantici, Curr. Organic Chem., 7, 1399-1422 [2003]). In general, the serine proteases have been more widely utilized in detergents, at least partially due to the relative ease with which these proteases can be stabilized.
- metalloproteases are less frequently used in industry, and particularly in the detergent industry for a number of reasons. These enzymes involve more complex protein systems, as the enzymes have the absolute requirement for calcium and zinc ions for stability and function, respectively. Further, the detergent solution as well as the water used in the laundry process often contains components that often interfere with the binding of the ions by the enzyme or chelate these ions, resulting in a decrease or loss of proteolytic function and destabilization of the protease.
- the autolysis model for NprE in the presence of citrate may be represented by the equation:
- N is the native form
- I represents a partially -folded intermediate
- a P is the autolysed protease.
- citrate most likely destabilizes the protein structure by removing calcium ions resulting in a partially unfolded intermediate (I) state, making loops and surface residues susceptible to autolysis.
- the generation of the autolysed protein fragments would be rapid and of high order. Stabilizing substitutions at or near these regions resulted in NprE variants that are less susceptible to autolysis.
- the model for the variants is most likely similar to that for the wild type except that the generation of autolysed protein (A P ) has been substantially slowed.
- the S129I-F130L-M138L-V190I-D220P molecule is completely active and structurally intact in the presence of 100 mM citrate when incubated at room temperature overnight.
- the calorimetric determination of the thermal melting points, in the presence of citrate, for the single and multiple combinatorial variants showed additivity and the apparent ⁇ Tm is +10 0 C.
- the present invention provides extremely beneficial opportunities for application in the production and development of industrial detergents containing NprE variants.
- the enzymes levels are expressed by pure enzyme by weight of the total composition and unless otherwise specified, the detergent ingredients are expressed by weight of the total compositions.
- the neutral metalloproteases of the present invention are useful m formulating various detergent compositions.
- the cleaning composition of the present invention may be advantageously employed for example, in laundry applications, hard surface cleaning, automatic dishwashing applications, as well as cosmetic applications such as dentures, teeth, hair and skin.
- the enzymes of the present invention are ideally suited for laundry applications such as the bleaching of fabrics.
- the enzymes of the present invention find use in both granular and liquid compositions.
- a cleaning additive product including at least one enzyme of the present invention is ideally suited for inclusion in a wash process when additional bleaching effectiveness is desired. Such instances include, but are not limited to low temperature solution cleaning applications.
- the additive product may be, in its simplest form, one or more neutral metalloprotease enzyme as provided by the present invention.
- the additive is packaged in dosage form for addition to a cleaning process where a source of peroxygen is employed and increased bleaching effectiveness is desired.
- the single dosage form comprises a pill, tablet, gelcap or other single dosage unit including pre-measured powders and/or liquids.
- filler and/or carrier material(s) are included, in order to increase the volume of such composition.
- Suitable filler or carrier materials include, but are not limited to, various salts of sulfate, carbonate and silicate as well as talc, clay and the like.
- filler and/or carrier materials for liquid compositions include water and/or low molecular weight primary and secondary alcohols including polyols and diols. Examples of such alcohols include, but are not limited to, methanol, ethanol, propanol and isopropanol.
- the compositions comprise from about 5% to about 90% of such materials.
- acidic fillers are used to reduce the pH of the composition.
- the cleaning additive includes at least one activated peroxygen source as described below and/or adjunct ingredients as more fully described below.
- the cleaning compositions and cleaning additives of the present invention require an effective amount of neutral metalloprotease enzyme as provided in the present invention, In some embodiments, the required level of enzyme is achieved by the addition of one or more species of neutral metalloprotease provided by the present invention.
- the cleaning compositions of the present invention comprise at least 0.0001 weight percent, from about 0.0001 to about 1, from about 0.001 to about 0.5, or even from about 0.01 to about 0.1 weight percent of at least one neutral metalloprotease provided by the present invention.
- the cleaning compositions provided herein are typically formulated such that, during use in aqueous cleaning operations, the wash water has a pH of from about 5.0 to about 11.5, or in alternative embodiments, even from about 6.0 to about 10.5.
- liquid product formulations are typically formulated to have a neat pH from about 3.0 to about 9.0, while in some alternative embodiments the formulation has a neat pH from about 3 to about 5.
- granular laundry products are typically formulated to have a pH from about 8 to about 11. Techniques for controlling pH at recommended usage levels include the use of buffers, alkalis, acids, etc., and are well known to those skilled in the art.
- the neutral metalloprotease when at least one neutral metalloprotease is employed in a granular composition or liquid, the neutral metalloprotease is in the form of an encapsulated particle to protect the enzyme from other components of the granular composition during storage.
- encapsulation also provides a means of controlling the availability of the neutral metalloprotease(s) during the cleaning process and may enhance performance of the neutral metalloprotease(s). It is contemplated that the encapsulated neutral metalloproteases of the present invention will find use in various settings. It is also intended that the neutral metalloprotease be encapsulated using any suitable encapsulating material(s) and method(s) known in the art.
- the encapsulating material typically encapsulates at least part of the neutral metalloprotease catalyst.
- the encapsulating material is water-soluble and/or water-dispersible.
- the encapsulating material has a glass transition temperature (Tg) of 0 0 C or higher (See e.g., WO 97/11151, particularly from page 6,line 25 to page 7, line 2, for more information regarding glass transition temperatures).
- the encapsulating material is selected from the group consisting of carbohydrates, natural or synthetic gums, chitin and chitosan, cellulose and cellulose derivatives, silicates, phosphates, borates, polyvinyl alcohol, polyethylene glycol, paraffin waxes and combinations thereof.
- the encapsulating material is a carbohydrate, it is selected from the group consisting of monosaccharides, oligosaccharides, polysaccharides, and combinations thereof.
- the encapsulating material is a starch (See e.g., EP 0922 499; US 4,977,252. US 5,354,559, and US 5,935,826, for descriptions of some exemplary suitable starches).
- the encapsulating material comprises a microsphere made from plastic(e.g., thermoplastics, acrylonitrile, methacrylonitrile, polyacrylonitrile, polymethacrylonitrile and mixtures thereof; commercially available microspheres that find use include, but are not limited to EXPANCEL® [Casco Products, Sweden] , PM 6545, PM 6550, PM 7220, PM 7228, EXTENDOSPHERES®, and Q-CEL® [PQ Corp., Valley Forge, PA], LUXSIL® and SPHERICELl® [Potters Industries, Inc., Carlstadt, NJ and Valley Forge, PA]).
- plastic e.g., thermoplastics, acrylonitrile, methacrylonitrile, polyacrylonitrile, polymethacrylonitrile and mixtures thereof; commercially available microspheres that find use include, but are not limited to EXPANCEL® [Casco Products, Sweden] , PM 6545, PM 6550, PM 7220, PM 72
- compositions of the present invention are formulated into any suitable form and prepared by any process chosen by the formulator, (See e.g., U.S. 5,879,584, U.S. 5,691,297, U.S. 5,574,005, U.S. 5,569,645, U.S. 5,565,422, U.S. 5,516,448, U.S. 5,489,392, and U.S. 5,486,303, for some non-limitmg examples).
- the pH of such composition is adjusted via the addition of an acidic material such as HCl.
- adjuncts described herein are suitable for use in the cleaning compositions of the present invention. Indeed, in some embodiments, adjuncts are incorporated into the cleaning compositions of the present invention. In some embodiments, adjunct materials assist and/or enhance cleaning performance, treat the substrate to be cleaned, and/or modify the aesthetics of the cleaning composition (e.g., perfumes, colorants, dyes, etc.). It is understood that such adjuncts are in addition to the neutral metalloproteases of the present im-ention. The precise nature of these additional components, and levels of incorporation thereof, depends on the physical form of the composition and the nature of the cleaning operation for which it is to be used.
- Suitable adjunct materials include, but are not limited to, surfactants, builders, chelating agents, dye transfer inhibiting agents, deposition aids, dispersants, additional enzymes, and enzyme stabilizers, catalytic materials, bleach activators, bleach boosters, hydrogen peroxide, sources of hydrogen peroxide, preformed peracids, polymeric dispersing agents, clay soil removal/anti-redeposition agents, brighteners, suds suppressors, dyes, perfumes, structure elasticizing agents, fabric softeners, carriers, hydrotropes, processing aids and/or pigments.
- additional examples are known in the art (See e.g., U.S. Patent Nos. 5,576,282, 6,306,812 Bl and 6,326,348 Bl).
- the aforementioned adjunct ingredients constitute the balance of the cleaning compositions of the present invention.
- the cleaning compositions of the present invention comprise at least one surfactant or surfactant system, wherein the surfactant is selected from nonionic surfactants, anionic surfactants, cationic surfactants, ampholytic surfactants, zwitterionic surfactants, semi-polar nonionic surfactants, and mixtures thereof.
- the surfactant is selected from nonionic surfactants, anionic surfactants, cationic surfactants, ampholytic surfactants, zwitterionic surfactants, semi-polar nonionic surfactants, and mixtures thereof.
- the composition typically does not contain alkyl ethoxylated sulfate, as it is believed that such surfactant may be hydrolyzed by such compositions the acidic contents.
- the surfactant is present at a level of from about 0.1% to about 60%, while in alternative embodiments, the level is from about 1% to about 50% , while in still further embodiments, the level is from about 5% to about 40%, by weight of the cleaning composition.
- the cleaning compositions of the present invention comprise one or more detergent builders or builder systems. In some embodiments incorporating at least one builder, the cleaning compositions comprise at least about 1%, from about 3% to about 60% or even from about 5% to about 40% builder by weight of the cleaning composition.
- Builders include, but are not limited to, the alkali metal, ammonium and alkanolammonium salts of polyphosphates, alkali metal silicates, alkaline earth and alkali metal carbonates, aluminosilicate builders polycarboxylate compounds, ether hydroxypolycarboxylates, copolymers of maleic anhydride with ethylene or vinyl methyl ether, 1, 3, 5-trihydroxy benzene- 2, 4, 6-trisulphonic acid, and carboxymethyloxysuccmic acid, the various alkali metal, ammonium and substituted ammonium salts of polyacetic acids such as ethylenediamine tetraacetic acid and nitrilotriacetic acid, as well as polycarboxylates such as mellitic acid, succinic acid, citric acid, oxydisuccinic acid, polymaleic acid, benzene 1,3,5-tricarboxylic acid, carboxymethyloxysuccinic acid, and soluble salts thereof. Indeed,
- the cleaning compositions of the present invention contain at least one chelating agent, Suitable chelating agents include, but are not limited to copper, iron and/or manganese chelating agents and mixtures thereof. In embodiments in which at least one chelating agent is used, the cleaning compositions of the present invention comprise from about 0.1% to about 15% or even from about 3.0% to about 10% chelating agent by weight of the subject cleaning composition.
- the cleaning compositions of the present invention include at least one deposition aid.
- Suitable deposition aids include, but are not limited to polyethylene glycol, polypropylene glycol, polycarboxylate, soil release polymers such as polytelephthalic acid, clays such as kaolinite. montmorillonite, atapulgite, lllite, bentonite, halloysite, and mixtures thereof.
- the cleaning compositions of the present invention include one or more dye transfer inhibiting agents.
- Suitable polymeric dye transfer inhibiting agents include, but are not limited to, polyvinylpyrrolidone polymers, polyamine N-oxide polymers, copolymers of N-vinylpyrrolidone and N-vinylimidazole, polyvinyloxazolidones and polyvinylimidazoles or mixtures thereof.
- the cleaning compositions of the present invention comprise from about 0.0001% to about 10%, from about 0.01% to about 5%, or even from about 0.1% to about 3% by weight of the cleaning composition.
- the cleaning compositions of the present invention contains at least one dispersants.
- Suitable water-soluble organic materials include, but are not limited to the homo- or co-polymeric acids or their salts, in which the polycarboxylic acid comprises at least two carboxyl radicals separated from each other by not more than two carbon atoms.
- the cleaning compositions of the present invention comprise one or more detergent enzymes which provide cleaning performance and/or fabric care benefits.
- suitable enzymes include, but are not limited to, hemicellulases, peroxidases, proteases, cellulases, xylanases, lipases, phospholipases, esterases, cutinases, pectinases, keratinases.
- reductases oxidases, phenoloxidases, lipoxygenases, ligninases, pullulanases, tannases, pentosanases, malanases, ⁇ -glucanases, arabinosidases, hyaluronidase, chondroitinase. laccase, and amylases, or mixtures thereof.
- a combination of enzymes i.e., a "cocktail" comprising conventional applicable enzymes like protease, lipase, cutinase and/or cellulase in conjunction with amylase is used.
- Enzyme Stabilizers In some embodiments of the present invention, the enzymes used in the detergent formulations of the present invention are stabilized. It is contemplated that various techniques for enzyme stabilization will find use in the present invention. For example, in some embodiments, the enzymes employed herein are stabilized by the presence of water- soluble sources of zinc (II), calcium (II) and/or magnesium (II) ions m the finished compositions that provide such ions to the enzymes, as well as.
- the cleaning compositions of the present invention contain one or more catalytic metal complexes.
- a metal- containing bleach catalyst finds use.
- the metal bleach catalyst comprises a catalyst system comprising a transition metal cation of defined bleach catalytic activity, (e.g., copper, iron, titanium, ruthenium, tungsten, molybdenum, or manganese cations), an auxiliary metal cation having little or no bleach catalytic activity (e.g., zinc or aluminum cations), and a sequestrate having defined stability constants for the catalytic and auxiliary metal cations, particularly ethylenediaminetetraacetic acid, ethylenediaminetetra (methylenephosphonic acid) and water-soluble salts thereof are used (See e.g., U.S. 4,430,243).
- a transition metal cation of defined bleach catalytic activity e.g., copper, iron, titanium, ruthenium, tungsten, molybdenum, or manganese cations
- an auxiliary metal cation having little or no bleach catalytic activity e.g., zinc or aluminum cations
- the cleaning compositions of the present invention are catalyzed by means of a manganese compound.
- a manganese compound Such compounds and levels of use are well known in the art (See e.g., U.S. 5,576,282).
- cobalt bleach catalysts find use in the cleaning compositions of the present invention.
- Various cobalt bleach catalysts are known in the art (See e.g., U.S. 5,597,936, and U.S. 5,595,967).
- Such cobalt catalysts are readily prepared by known procedures (See e.g., U.S. 5,597,936, and U.S. 5,595,967).
- the cleaning compositions of the present invention include a transition metal complex of a macropolycyclic rigid ligand ("MRL").
- MRL macropolycyclic rigid ligand
- the compositions and cleaning processes provided by the present in ⁇ ention are adjusted to provide on the order of at least one part per hundred million of the active MRL species in the aqueous washing medium, and in some preferred embodiments, provide from about 0.005 ppm to about 25 ppm, more preferably from about 0.05 ppm to about 10 ppm, and most preferably from about 0.1 ppm to about 5 ppm, of the MRL in the wash liquor.
- Preferred transition-metals in the instant transition-metal bleach catalyst include, but are not limited to manganese, iron and chromium.
- Preferred MRLs also include, but are not limited to special ultra-rigid ligands that are cross-bridged (e.g., 5,12-diethyl-l,5,8,12- tetraazabicyclo[6.6.2]hexadecane).
- Suitable transition metal MRLs are readily prepared by known procedures (See e.g., WO 00/32601, and U.S. 6,225,464).
- the cleaning compositions of the present in ⁇ ention are formulated into any suitable form and prepared by any suitable process chosen by the formulator, (See e.g., U.S. 5,879.584, U.S. 5,691,297, U.S. 5,574,005, U.S. 5,569,645, U.S. 5,565,422, U.S. 5,516,448, U.S. 5,489,392, U.S. 5,486,303, U.S. 4,515,705, U.S. 4,537,706, U.S. 4,515,707, U.S. 4,550,862, U.S. 4,561,998, U.S. 4,597,898, U.S. 4,968,451, U.S. 5,565,145, U.S. 5,929,022, U.S. 6,294,514, and U.S. 6,376,445, all of which are incorporated herein by reference for some non-limiting examples).
- the cleaning compositions of the present invention find use in cleaning surfaces and/or fabrics.
- at least a portion of the surface and/or fabric is contacted with at least one embodiment of the cleaning compositions of the present invention, in neat form or diluted in a wash liquor, and then the surface and/or fabric is optionally washed and/or rinsed.
- "washing" includes, but is not limited to, scrubbing, and mechanical agitation.
- the fabric comprises any fabric capable of being laundered in normal consumer use conditions.
- the cleaning compositions of the present invention are used at concentrations of from about 500 ppm to about 15,000 ppm in solution.
- the wash solvent is water
- the water temperature typically ranges from about 5 0 C to about 90 0 C.
- the water to fabric mass ratio is typically from about 1 : 1 to about 30:1.
- CTGCAGGAATTCAGATCTTAACATTTTTCCCCTATCATTTTTCCCG SEQ ID NO:5 (NprE primer) GGATCCAAGCTTCCCGGGAAAAGACATATATGATCATGGTGAAGCC SEQ ID NO:6 (pUB-Bglll-FW)
- SEQ ID NO:7 (pUB-Bglll-RV) GTCTCGAAGATCTGATTGCTTAACTGCTTC
- SEQ ID NO: 15 (NprE Fragment 3) AATTGTGTTLTVSLNISSESGKDLSKPTGTQIITYDLQNREYNLPGTLVSSTTNQFTTSSQ RAAVDAHYNLGKNSYDNKIVSSVHYGSRYNNAAWIGDQMIYGDGDGSFFSPLSGSMD
- SEQ ID NO: 19 (NprE M138L/V190I/D220P) AATTGTGTTLKGKTVSLNISSESGKYVLRDLSKPTGTQIITYDLQNREYNLPGTLVSSTT NQFTTSSQRAAVDAHYNLGKVYDYFYQKFNRNSYDNKGGKIVSSVHYGSRYNNAAWI GDQMIYGDGDGSFFSPLSGSLDVTAHEMTHGVTQETANLNYENQPGALNESFSDVFGYF NDTEDWDIGEDITISQPALRSLSNPTKYGQPDNFKNYKNLPNTPAGDYGGVHTNSGIPNK AAYNTITKIGVNKAEQIYYRALTVYLTPSSTFKDAKAALIQSARDLYGSQDAASVEAAW NAVGL
- BCA (Pierce) assay was used to determine the protein concentration in protease samples on MTP scale.
- the chemical and reagent solutions used were: BCA protein assay reagent, and Pierce Dilution buffer (50 mM MES, pH 6.5, 2mM CaCl 2 , 0.005% TWEEN®-80).
- the equipment used was a SpectraMAX (type 340) MTP reader.
- the MTPs were obtained from Costar (type 9017).
- the Bradford dye reagent (Quick Start) assay was used to determine the protein concentration in protease samples on MTP scale.
- the chemical and reagent solutions used were: Quick Start Bradford Dye Reagent (BIO-RAD Catalog No. 500-0205), Dilution buffer (1OmM NaCl, O.lmM CaC12, 0.005% TWEEN®-80).
- the equipment used was a Biomek FX Robot (Beckman) and a SpectraMAX (type 340) MTP reader.
- the MTPs were from Costar (type 9017).
- 200 ⁇ l Bradford Dye Reagent was pipetted into each well, followed by 15 ⁇ l dilution buffer. Finally 10 ⁇ l of filtered culture broth were added to the wells. After thorough mixing, the MTPs were incubated for at least 10 minutes at room temperature.
- Citrate stability was measured after incubation of wild-type NprE and variants in the presence of mM citrate.
- the initial and residual activity was determined using the DMC hydrolysis assay.
- the chemical and reagent solutions used were:
- Dilution buffer 2 0.1 mM CaC12/50 mM Citrate/25 mM Tris ; pH8.2
- the PIPES buffer was adjusted to pH 5.8 with 4 N HCl (final concentration of 55 mM).
- the Tris buffer was adjusted to pH 8.2 with 4 N HCl (final concentration of 25 mM).
- the 50 mM citrate/25 mM Tris buffer was adjusted to pH 8.2 with 4 N NaOH.
- the HEPES buffer was adjusted to pH 8.2 with 4 N NaOH (final concentration of 25 mM).
- the 50 mM citrate/25 mM HEPES buffer was adjusted to pH 8.2 with 4 N NaOH.
- the protease concentration of the wild-type NprE controls for each plate were determined with the TCA assay.
- 25 ⁇ l filtered culture broth were added to 200 ⁇ l 16.875% (w/v) TCA. After incubation for 10 to 15 minutes at ambient temperature, the light scattering/absorbance at 405 nm was determined. The protein concentration was determined by using a calibration line, constructed with purified NprE.
- the filtered culture broth was diluted with dilution buffer 2.
- the MTP was covered with tape, shaken for a few seconds and placed in the incubator at 25 0 C for 60 minutes at 200 rpm. After incubation, 20 ⁇ l of the mixture were taken from each well and transferred into a new MTP, containing 180 ⁇ l 1% DMC preheated substrate solution (the substrate was preheated at 25 0 C).
- the MTP was placed directly in the incubator/shaker and incubated at 25 0 C for 30 minutes at 200 rpm agitation.
- the residual protease activity was determined using the dimethylcasein hydrolysis assay, described below.
- the filtered culture broth was diluted with dilution buffer 1. Immediately, 20 ⁇ l of the mixture were taken from each well and transferred into a new MTP, containing 180 ⁇ l of preheated 1% DMC substrate solution (the substrate was preheated at 25 0 C). The MTP was placed directly in the incubator/shaker and incubated for 25 0 C for 30 minutes at 200 rpm agitation. The initial protease activity as determined with TNBS, using the dimethylcasein hydrolysis assay, described below.
- % Residual Activity OD 50 m value * 100/OD 00 mn value
- PIPES buffer (free acid) Sigma P-1851 ; 15.1 g dissolved in about 960 ml water; pH adjusted to 6.0 with 4N NaOH, 1 ml of 5% TWEEN®-80 added and the volume brought up to 1000 ml. Final concentration of PIPES and TWEEN®-80: 50 mM and 0.005% respectively.
- Reagent A 45.4 g Na 2 B 4 O 7 JO H2O (Merck 6308) and
- Reagent B 35.2 g NaH 2 PO 4 IH 2 O (Merck 6346) and 0.6 g Na 2 SO 3 (Merck
- the substrate 4 g dimethylcasem was dissolved in 400 ml PIPES buffer. The filtered culture supernatants were diluted with PIPES buffer. Then, 10 ⁇ l of each diluted supernatant were added to 200 ⁇ l substrate in the wells of a MTP. The MTP was covered with tape, shaken for a few seconds and placed in an oven at 25 0 C for 30 minutes without agitation. About 15 minutes before removal of the 1 st plate from the oven, the TNBS reagent was prepared by mixing 1 ml TNBS solution per 50 ml of Reagent A. MTPs were filled with 60 ⁇ l TNBS Reagent A per well.
- the incubated plates were shaken for a few seconds, after which 10 ⁇ l was transferred to the MTPs with TNBS Reagent A.
- the plates were covered with tape and shaken for 20 minutes in a bench shaker (BMG Thermostar) at room temperature and 500 rpm.
- 200 ⁇ l Reagent B was added to the wells, mixed for 1 minute on a shaker, and the absorbance at 405 nm was determined using a MTP reader.
- the obtained absorbance value was corrected for the blank value (i.e., substrate without enzyme).
- the resulting absorbance was a measure of the hydrolytic activity.
- the (arbitrary) specific activity of a sample was calculated by dividing the absorbance and the determined protein concentration.
- Neutral metalloproteases cleave the peptide bond between glycine and leucine of 2-aminobenzoyl-L-alanylglycyl-L-leucyl-L-alanino-4- nitrobenzylamide (Abz-AGLA-Nba).
- Free 2-aminobenzoyl-L-alanylglycine (Abz-AG) in solution has a fluorescence emission maximum at 415 nm with an excitation maximum of 340 nm. Fluorescence of Abz-AG is quenched by nitrobenzylamide in the intact Abz-AGLA-Nba molecule.
- a microplate mixer with temperature control (e.g., Eppendorf Thermomixer) was required for reproducible assay results.
- the assay solutions were incubated to desired temperature (e.g., 25 0 C) in the microplate mixer prior to enzyme addition. Enzyme solutions were added to the plate in the mixer, mixed vigorously and rapidly transferred to the plate reader.
- a spectrofluorometer with capability of continuous data recording, linear regression analysis, and temperature control was required (e.g., SpectraMax M5, Gemini EM, Molecular Devices).
- the reader was always maintained at the desired temperature (e.g., 25 0 C).
- the reader was set for top-read fluorescence detection and the excitation was set to 350 nm and emission to 415 nm without the use of a cut-off filter.
- the PMT was set to medium sensitivity and 5 readings per well. Autocalibration was turned on, but only to calibrate before the first reading.
- the assay was measured for 3 minutes with the reading interval minimized according to the number of wells being monitored.
- the reader was set to calculate the rate of milli-RFU/min (thousandths of relative fluorescence units per minute).
- the number of readings used to calculate the rate (Vmax points) was set to the number equivalent to 2 minutes, as determined by the reading interval (e.g., a reading every 10 seconds would use 12 points to calculate the rate).
- the max RFU was set to 50,000. All pipeting of enzyme and substrate stock solutions were done with positive displacement pipets (Rainin Microman). Buffer, assay, and enzyme working solutions were pipetted by single or multi-channel air-displacement pipets (Rainin LTS) from tubes, reagent reservoirs or stock microplates.
- a repeater pipet finds use in transferring the assay solution to microplate wells when few wells are used, to minimize reagent loss.
- Automated pipetting instruments such as the Beckman FX or Cybio Cybi-well also find use in transferring enzyme solutions from a working stock microplate to the assay microplate in order to initiate an entire microplate at once.
- MES acid (10.28 g) and 292 mg anhydrous CaCl 2 were dissolved in approximately 90OmL purified water.
- the solution was titrated with NaOH to pH 6.5 (at 25 0 C or with temperature adjustment pH probe).
- the pH-adjusted buffer was made up to IL total volume.
- the final solution was filtered through a 0.22 ⁇ m sterile filter and kept at room temperature.
- Abz-AGLA-Nba Approximately 28 mg of Abz-AGLA-Nba was placed in a small tube. It was dissolved in DMF (volume will vary depending upon Abz-AGLA-Nba massed) and vortexed for several minutes. The solution was stored at room temperature shielded from light.
- This buffer was produced by adding 5 mL purified water to 95 mL MES Buffer.
- Enzyme solutions The enzyme stock solutions were diluted with enzyme dilution buffer to a concentration of approximately 1 ppm (1 ug/mL). MULTIFECT® neutral protease (wild-type NprE) was diluted to concentrations below 6 ppm (6 ug/mL). Serial dilutions were preferred. Solutions were stable at room temperature for 1 hour, but for longer term storage, the solutions were maintained on ice.
- a 200 ⁇ L aliquot of assay solution were placed in the wells of a 96-well microplate.
- the plate was incubated for 10 min at 25 0 C in a temperature controlled microplate mixer, shielded from light.
- the assay was initiated by transferring 10 uL of the working enzyme solutions from the stock microplate to the assay microplate in the mixer.
- 96-well pipetting head finds use, or an 8-well multi-channel pipet was used to transfer from the left-most column first.
- the solutions were vigorously mixed for 15 seconds (900rpm m Eppendorf Thermomixer).
- the assay microplate was transferred to the microplate spectrofluorometer and recording of fluorescence measurements at excitation of 350 nm and emission of 415 nm were begun.
- the spectrofluorometer software calculated the reaction rates of the increase in fluorescence for each well to a linearly regressed line of milli-RFU / min.
- a second plate was placed in the microplate mixer for temperature equilibration while the first plate was being read. The rate initial velocities were linear with respect to product concentration (i.e., liberated
- nprE leader, nprE pro and nprE mature DNA sequence from B.amyloliquefaciens encodes the NprE precursor protein:
- the mature NprE sequence is set forth as SEQ ID NO:3. This sequence was used as the basis for making the variant libraries described herein.
- the pUBnprE expression vector was constructed by amplifying the nprE gene from the chromosomal DNA of B. amyloliquefaciens by PCR using two specific primers: Oligo AB 1740: CTGCAGGAATTCAGATCTTAACATTTTTCCCCTATCATTTTTCCCG (SEQ ID NO:4) Oligo AB 1741: GGATCCAAGCTTCCCGGGAAAAGACATATATGATCATGGTGAAGCC (SEQ ID NO:5)
- PCR was performed on a thermocycler with Phusion High Fidelity DNA polymerase (Finnzymes.
- the PCR mixture contained 10 ⁇ l 5x buffer (Finnzymes Phusion), l ⁇ l 1OmM dNTP's, 1.5 ⁇ l DMSO, l ⁇ l of each primer, l ⁇ l Finnzymes Phusion DNA polymerase, l ⁇ l chromosomal DNA solution 50ng/ ⁇ l, 34.5 ⁇ l MiUiQ water.
- the following protocol was used:
- the multicopy Bacillus vector pUB 110 See e.g., Gryczan, J Bacteriol,
- B. subtilis ( ⁇ aprE, ⁇ nprE, oppA, ⁇ spoIIE, degUHy32, ⁇ amyE: :(xylR,pxylA-comK) strain. Transformation into B. subtilis was performed as described in WO 02/14490, incorporated herein by reference. Selective growth of B.
- subtilis transformants harboring the pUBnprE vector was performed m shake flasks containing 25 ml MBD medium (a MOPS based defined medium), with 20 mg/L neomycin.
- MBD medium was made essentially as known in the art ⁇ See, Neidhardt et al, J Bacteriol, 119: 736-747, 1974), except that NH 4 Cl 2 . FeSO 4 , and CaCl 2 were left out of the base medium, 3 mM K 2 HPO 4 was used, and the base medium was supplemented with 60 mM urea, 75 g/L glucose, and 1 % soytone.
- the micronutrients were made up as a 100 X stock containing in one liter, 400 mg FeSO 4 .7H 2 0, 100 mg MnSO 4 .H 2 O, 100 mg ZnSO 4 JH 2 O, 50 mg CuCl 2 .2H 2 0, 100 mg CoCl 2 .6H 2 0, 100 mg NaMoO 4 .2H 2 O, 100 mg Na 2 B 4 O 7 JOH 2 O, 10 ml of IM CaCl 2 , and 10 ml of 0.5 M sodium citrate.
- the culture was incubated for three days at 37°C in an incubator/shaker (Infors).
- the pUBnprE vector containing the nprE expression cassette described above, served as template DNA.
- This vector contains a unique BgIM restriction site, which was utilized in the site evaluation library construction. Briefly, to construct a nprE site evaluation library, three PCR reactions were performed, including two mutagenesis PCRs to introduce the mutated codon of interest in the mature nprE DNA sequence and a third PCR used to fuse the two mutagenesis
- N A, C, T or G
- S C or G
- Two additional primers used to construct the site evaluation libraries contained the BgIW restriction site together with a part of the pUBnprE DNA sequence flanking the BgIW restriction site. These primers were produced by Invitrogen (50 nmole scale, desalted): pUB-Bglll-FW GTCAGTCAGATCTTCCTTCAGGTTATGACC (SEQ ID NO:6); and pUB-Bglll-RV GTCTCGAAGATCTGATTGCTTAACTGCTTC (SEQ ID NO:7).
- each SEL started with two primary PCR amplifications using the pUB- BgIII-FW primer and a specific nprE reverse mutagenesis primer.
- the pUB- BgIII -RV primer and a specific nprE forward mutagenesis primer were used.
- the PCR program was: 30 seconds 98 0 C, 30x (10 seconds 98°C, 20 seconds 55°C, 1.5 minute 72°C) and 5 min 72°C, performed in a PTC-200 Peltier thermal cycle (MJ Research).
- the PCR experiments result in two fragments of approximately 2 to 3 kB, which had about 30 nucleotide base overlap around the NprE mature codon of interest. Fragments were fused in a third PCR reaction using these two aforementioned fragments and the forward and reverse Bglll primers.
- the fusion PCR reaction was carried out in the following solution:
- the PCR fusion program was as follows: 30 seconds 98°C, 30x (10 seconds 98 0 C, 20 seconds 55 0 C, 2:40 minute 72°C) and 5 min 72 0 C, in a PTC-200 Peltier thermal cycler (MJ Research).
- the amplified linear 6.5 Kb fragment was purified using the Qiaquick PCR purification kit (Qiagen, Catalog No. 28106) and digested with Bglll restriction enzyme to create cohesive ends on both sides of the fusion fragment:
- B. subtilis ( ⁇ aprE, AnprE, oppA, AspoIIE, degUHy32, AamyE::(xylR,pxylA-comK) strain. Transformation to B. subtilis was performed as described in WO 02/14490, incorporated herein by reference. For each library, 96 single colonies were picked and grown in MOPS media with neomycin and 1.25 g/L yeast extract for sequence analysis (BaseClear) and screening purposes. Each library included a maximum of 19 nprE site-specific variants.
- the variants were produced by growing the B. subtilis SEL transformants in 96 well MTP at 37 0 C for 68 hours in MBD medium with 20 mg/L neomycin and 1.25 g/L yeast extract.
- nprE SELs Alternative methods to generate nprE SELs are also described. These methods are suitable for production of SELs of other enzymes of interest.
- the pUBnprE vector containing the nprE expression cassette served as the template DNA source for the generation of nprE SELs and NprE variants.
- the major difference between the two methods is that this method requires amplification of the entire vector using complementary site-directed mutagenic primers.
- Competent B. subtilis cells (AaprE, AnprE, oppA, AspoIIE, degUHy32, AamyE::(xylR,pxylA- comK)
- the cell pellet was harvested by sufficient centrifugation to provide a cell pellet.
- the cell pellet was resuspended in 10 ml Buffer Pl (Qiagen Plasmid Midi Kit). Then, lO ⁇ l of Ready-Lyse Lysozyme was added to the resuspended cell pellet and incubated at 37°C for 30 min.
- the Qiagen Plasmid Midi Kit protocol was continued using 10 ml of Buffer P2 and P3 to account for the increased volume of cell culture. After isolation from Bacillus of each pUBnprE plasmid containing a single nprE mutation, the concentration of each plasmid was determined.
- the plasmids were then dam methylated using the dam Methylase Kit (New England Biolabs) per the manufacturer's instructions, to methylate approximately 2 ⁇ g of each pUBnprE plasmid per tube.
- the Zymoclean Gel DNA recovery kit was used to purify and concentrate the dam- methylated pUBnprE plasmids.
- the dam-methylated pUBnprE plasmids were then quantitated and diluted to a working concentration of 50 ng/ ⁇ l for each. Mixed site-directed mutagenic primers were prepared separately for each reaction.
- the mixed site-directed mutagenic primer tube would contain 10 ⁇ l of nprE-S23R, 10 ⁇ l nprE-G24R, 10 ⁇ l nprE-N46K, and 10 ⁇ l nprE-T54R (all primers at 10 ⁇ M each).
- a PCR reaction using the QuikChange Multi Site-Directed Mutagenesis Kit was performed following the manufacturer's instructions (e.g., 1 ⁇ l dam methylated pUBnprE plasmid containing one mutation (50 ng/ ⁇ l), 2 ⁇ l nprE site-directed mutagenic primers (10 ⁇ M), 2.5 ⁇ l 10x QuikChange Multi Reaction buffer, 1 ⁇ l dNTP Mix, 1 ⁇ l QuikChange Multi enzyme blend (2.5U/ ⁇ l), and 17.5 ⁇ l distilled, autoclaved water, to provide a 25 ⁇ l total reaction mix.
- the nprE variant libraries were amplified using the following conditions: 95 0 C, for 1 min.
- reaction mixture underwent Dpnl digest treatment (supplied with QUIKCHANGE® Multi Site-Directed Mutagenesis Kit) to digest parental pUB-nprE plasmid, using the manufacturer's protocol (i.e., 1.5 ⁇ l Dpt ⁇ restriction enzyme was added to each tube and incubated at 37°C for 3 hours; 2 ⁇ l of Dpnl-digested PCR reaction was then analyzed on a 1.2% E-gel to ensure PCR reaction worked and that parental template was degraded.
- Dpnl digest treatment supplied with QUIKCHANGE® Multi Site-Directed Mutagenesis Kit
- TempliPhi rolling circle amplification was then used to generate large amounts of DNA for increasing library size of the nprE multi variants, using the manufacturer's protocol (i.e., 1 ⁇ l Dpnl treated QuikChange Multi Site-Directed Mutagenesis PCR, 5 ⁇ l TempliPhi Sample Buffer, 5 ⁇ l TempliPhi Reaction Buffer, and 0.2 ⁇ l TempliPhi Enzyme Mix, for an ⁇ 11 ⁇ l total reaction; incubated at 30 0 C for 3 hours; the TempliPhi reaction was diluted by adding 200 ⁇ l distilled, autoclaved water and briefly vortexed.
- the manufacturer's protocol i.e., 1 ⁇ l Dpnl treated QuikChange Multi Site-Directed Mutagenesis PCR, 5 ⁇ l TempliPhi Sample Buffer, 5 ⁇ l TempliPhi Reaction Buffer, and 0.2 ⁇ l
- nprE multi variants were selected for using LA + 10 ppm Neomycin + 1.6 % skim milk plates. Colonies were picked and then sequenced to identify the different nprE variant library combinations.
- This Example describes the methods used to express, ferment and purify the proteases of the transformed B. subtilis of the preceding examples.
- the recombinant Bacillus subtilis was cultivated by conventional batch fermentation in a nutrient medium.
- One glycerol vial of a B. subtilis culture (containing the B. amyloliquefaciens neutral metalloprotease or a variant thereof) was used to inoculate 600 ml of SBG 1 % medium containing 200 mg/L chloramphenicol.
- the cultures were grown for 36-48 hours at 37°C.
- Alternative methods employed involved the growth of recombinant B. subtilis in defined media for 60 hours at 35 0 C.
- the culture fluid was subsequently recovered by centrifugation at 12,000 rpm, as known in the art (SOR V ALL® centrifuge model RC5B).
- the secreted neutral metalloproteases were isolated from the culture fluid and concentrated approximately 10-fold using an Amicon filter system 8400 with a BES (polyethersulfone) 10 kDa cutoff.
- the concentrated supernatant was dialyzed overnight at 4°C against 25 mM MES buffer, pH 5.4. containing 1 mM CaCl 2 .
- the dialyzate was then loaded onto a cation-exchange column Poros HS20 (Applied Biosystems column with a total volume ⁇ 83 mL; binding capacity ⁇ 4.5 g protein/mL column; waters).
- the column was pre-equilibrated with 25 mM MES buffer, pH 5.4, containing 1 mM CaCl 2 .
- the bound protein was eluted using a pH and salt gradient from 25 mM MES, pH 5.4, 1 mM CaCl 2 to 50 mM MES, pH 6.2, 2 mM CaCl 2 and 100 mM NaCl. Elution of the protein was between pH 5.8 and 6.0.
- the pure protein was concentrated and buffer- exchanged into 25 mM MES buffer, pH 5.8, containing 2 mM CaCl 2 , and 40% propylene glycol.
- the purity of the preparation was assessed by measuring proteolytic activity and by 10 % (w/v) NU-P AGE ® Novex SDS-PAGE (Invitrogen Corp.) and found to be greater than 95% .
- the autolysis of 0.4 mg/ml NprE was optimized by varying either: (a) the time of incubation (0-120 minutes) in 10 mM citrate; or (b) the citrate concentration (10-100 mM) over 100 minutes.
- a control of neutral metalloprotease diluted in buffer alone i.e., no citrate was incubated under similar conditions.
- the remaining protease activity was measured using the synthetic peptide (Abz-AGLA-Nba) and calculated relative to its own no-citrate control.
- the neutral metalloprotease NprE is inactivated m the presence of citrate, a weak calcium chelator.
- the autolytic reactions performed at 4 0 C were terminated by addition of an equal volume of IN HCl.
- the samples were precipitated using TCA and the pellet was washed and dried using acetone.
- the resultant pellet was resuspended in 20 ⁇ L buffer, pH 6.5, and 4X LDS sample buffer (NuPage, Invitrogen).
- the autolytic fragments were resolved by 10 % (w/v) SDS-PAGE and electroblotted onto a PVDF membrane.
- the first 10 amino acid residues were sequenced by Edman degradation (Argo Bioanalytica), and are shown in Table 5-1.
- the partial amino acid sequences of the autolytic fragments were determined using trypsin in-gel digestion and analyzed using LCQ-MS (Agilent).
- the in-gel digestion process involved macerating the gel piece that contained the protein, removal of the Coomassie blue stain followed by re-hydration of the gel pieces m 25 mM NH 4 CO 3 containing 2 M urea. Trypsin was added to the re-hydrated gel pieces for approximately 6 hours at 37 0 C. Following the digestion, the peptides were extracted using acetonitrile and TCA. The peptides were separated on a C4-hydrophobic column (Vydac) using an acetonitrile- water gradient. The resultant peptide maps were searched with the SEQUEST® database search program against a database containing Genencor enzymes.
- the amino acid sequences of the first 10 amino acids of each of the fragments were compared with the known amino acid sequence for B. amylohquefaciens NprE. This enabled the identification of the amino acid at the N-termini and hence the cleavage site(s) within NprE.
- the autolytic action of citrate on the wild-type neutral protease was studied in the presence of increasing citrate concentrations at 4 0 C as shown in Figure IB. After incubation for 90 minute with 10 mM citrate, two primary autolysis fragments in addition to the remaining intact NprE are observed (lane 1).
- the molecular weight of intact NprE is approximately 32 kDa, while the primary autolysis fragments are approximately 24 kDa and 9 kDa in size.
- An increase of the citrate concentration to 100 mM resulted in further autolysis and the generation of additional, secondary autolysis fragments (lanes 4-7).
- the 24 kDa- autolysis fragment is hydolysed further resulting in three smaller fragments of 21 kDa, 15 kDa and 11 kDa.
- the N-termini of the fragments were identified by Edman degradation ( Figure 2). Fragments 1 , 3 and 4 all have the native N-terminal sequence, whereas fragments 2 and 5 have unique N-termini. Fragment 2 is frayed and the start of the N-terminus is at or near D220, A221 or G222. The C-terminus of the 15 kDa fragment was deduced based on its size, and is at or near position L198. In-gel trypsin digestion and LCQ-MS confirmed the identity of these autolysis fragments. Based on the N-terminal and LCQ-MS analysis of the NprE cleavage fragments, primary cleavage sites were identified at amino acid positions M138, L198, D220, A221, and G222.
- the buffer used was 25 mM HEPES, pH 8.0, containing 0.1 mM CaCl 2 .
- Protease activity was measured using either the succmylated-casein/TNBSA method (Pierce, Inc. Rockford, IL) or the fluorescently labeled Abz-AGLA-Nba peptide assay (Vnend et al. J Biol Chem, 255:3482-3486, 1980).
- the spectrophotometer used was the SpectraMax M2 e (Molecular Devices) and all assays were conducted in medium protein-binding 96-well plates (Corning International). Residual protease activity was calculated for four replicates after incubation at room temperature for 60 minutes.
- the citrate-screening data indicated that replacement of M138 by Leu, D220 by Pro or GIu, S129 by lie or Leu, F130 by Leu, and V 190 by Leu or He resulted in proteases that were less susceptible towards citrate- induced autolysis.
- the citrate concentration dependence of stability for select neutral protease variants is shown in Figure 4A.
- the single amino acid substitution variants, S129I/V, M138I/L and D220E/P result in 20-30 % greater remaining activity than the wild-type protein, when incubated in the presence of 100 mM citrate at room temperature.
- V190I shows the greatest remaining activity ( ⁇ 60 %) after incubation in 100 mM citrate at room temperature for 60 minutes.
- the most citrate-stable variant is the combination of five individual mutations, S129I-F130L-M138L-V190I-D220P.
- This quintuple variant S129I-F130L-M138L-V190I-D220P retains all of its activity in the presence of 100 mM citrate for 150 minutes, and the improved stability is substantiated by the absence of autolysis fragments as observed by SDS-PAGE.
- the autolysis pattern characteristic of the wild type NprE (lanes 1-4) is contrasted with the absence of autolysis for S129I-F130L-M138L- V190I-D220P (lanes 6-10) in the presence of increasing concentrations of citrate, as shown in Figure 4B.
- the percentage remaining activity for wild type NprE and variants neutral metalloproteases in the presence of 100 mM citrate after incubation for 60 minutes at room temperature is shown in Figure 6, clearly indicating the additivity of single substitutions to resistance to autolysis.
- Scan rate dependence data of the thermal melting points for NprE was assessed over a scan rate of 25 to 200 °C/hr. A scan rate of 200 °C/hr was ultimately selected to minimize any artifacts that may result from aggregation or autolysis.
- the thermal midpoint (Tm) of the DSC curves was used as an indicator of the thermal stability.
- 440-ppm wild-type neutral protease displayed a thermal melting point (Tm) of 69.2 ⁇ 0.5 0 C.
- Tm thermal melting point
- the thermal melting points for the wild type and NprE variants is shown in Figure 6 indicating that the mutations have only a minimal effect on the thermal melting point in the absence of citrate.
- the citrate-stabilizing substitutions show additivity, and the combination of five point mutations in the protease backbone in the S 1291- F130L-M138L-V190I-D220P variant, has a Tm of 59.2 0 C.
- the combination of five improving mutations results in an increase in Tm of +10 0 C ( Figures 5 and 6). Taken together these results indicate that a correlation exists between resistance to citrate-induced autolysis and thermal stability in the presence of citrate.
- This example describes the modeling of the structure of B. amyloliquefaciens NprE based on the known structure of B. cereus NprE, to which it is 45% identical.
- micro PIXES analysis was used to confirm the stoichiometry and zinc and calcium binding of NprE. This model was used to identify amino acids of NprE that are likely to be solvent exposed.
- the co-ordinates for structures used in sequence analysis, alignment and modeling were downloaded from the PDB.
- the protein sequence of B. amyloliquefaciens NprE is found in Swissprot No. P06832, and the sequence of the mature form is set forth as SEQ ID NO:3.
- the program suite MOE (Chemical Computing Corp Montreal, Canada), was used for alignment calculations and manual re-adjustment, analysis and modeling, according to the manual supplied with the program.
- the Charmm27 parameter set was chosen for energy minimization calculations.
- the structures of zinc neutral proteases from ⁇ . cereus (INPC), B. thermoproteolyticus (PDB ID IKEI), P. aeruginosa (IEZM), and S. aureus (IBQB) are available.
- B. amyloliquefaciens NprE The most closely homologous of these structures to the mature protease domain of B. amyloliquefaciens NprE is the B. cereus NprE, which was used as the template structure for modeling. They were aligned structurally. Comparison to the sequence alignment revealed a number of insertions and deletions between the B. amyloliquefaciens NprE sequence, and the B. cereus NprE sequence. Inspection of the alignments revealed likely errors in both, and the alignment was adjusted manually. B. amyloliquefaciens NprE has a four residue deletion compared to the template INPC structure in a loop in which two Ca 2+ ions are predicted to bind to the protein. This led to initial difficulty in modeling this very important region.
- the S. aureus NprE which has the same stoichiometry of metal binding as B. amyloliquefaciens NprE, has an identical deletion in this loop.
- the B. amyloliquefaciens NprE homology model contains 300 residues of the mature enzyme.
- a Ramachandron plot of the final model reveals three outliers. They are S23, N61, and S 191.
- Analysis of surface exposed residues shows eight aliphatic or aromatic residues at the surface. They are Y49, L55, 1117, F130, V190, L216, V260, and L282. These residues are in surface exposed loops, which are generally those regions least accurately modeled using the homology modeling method, and may indicate regions where the model is less reliable.
- the N-terminal part of the B. amyloliquefaciens NprE enzyme contains an 8 strand mixed beta sheet, which encloses about 75% of the surface of a long helix.
- the C-terminal part of the enzyme largely consists of a 6 helical bundle and two short strands of anti-parallel beta-sheet.
- the active site of the enzyme is found at the interface between these two sub-domains.
- the substrate binding cleft is very large and open, which is consistent with the observed endo-protease activity.
- micro-PIXE micro-Particle-Induced X-ray Emission
- pH buffers were made using a combination of MES monohydrate, Trizma base and sodium acetate (all from Sigma). The final concentration of each component in the buffer was 25mM acetate, 5OmM MES and 25mM Tris. The pH of the buffers was adjusted using either sodium hydroxide or hydrochloride to final pH values of 9.40, 8.69, 8.36, 7.70, 7.45, 6.52, 6.00, 5.45, 4.78, and 4.27. AGLA substrate (American Peptide Company) was dissolved in DMF at a concentration of 4.8mM.
- the activity of each protein at varying pH was measured using the AGLA assay.
- the wild type NprE is most stable at pH 6.5, with decreases in stability observed at pH less than or greater to 6.5.
- NprE has lost 100 % activity.
- the Quint is very stable in a wide pH range of pH 5.5 to pH 9.4. Although at pH values less than 4.7, stability of Quint decreases.
- the addition of 2mM calcium stabilizes both NprE and the Quint variant at both low pH and high pH.
Abstract
Description
Claims
Priority Applications (11)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
JP2010532153A JP5498951B2 (en) | 2007-10-31 | 2008-10-23 | Use and production of neutral metalloproteases stabilized against citric acid |
CA2703975A CA2703975C (en) | 2007-10-31 | 2008-10-23 | Use and production of citrate-stable neutral metalloproteases |
US12/681,614 US20110081454A1 (en) | 2007-10-31 | 2008-10-23 | Use and production of citrate-stable neutral metalloproteases |
CN200880114393.1A CN101842481B (en) | 2007-10-31 | 2008-10-23 | Purposes and the production of the neutral metal protease to citrate-stable |
MX2010004372A MX2010004372A (en) | 2007-10-31 | 2008-10-23 | Use and production of citrate-stable neutral metalloproteases. |
BRPI0818788A BRPI0818788A2 (en) | 2007-10-31 | 2008-10-23 | use and production of stable neutral citrate metalloproteases. |
EP08845861A EP2205731B1 (en) | 2007-10-31 | 2008-10-23 | Use and production of citrate-stable neutral metalloproteases |
DK08845861.7T DK2205731T3 (en) | 2007-10-31 | 2008-10-23 | Use and preparation of citrate-stable, neutral metalloproteases |
US14/187,625 US20140315775A1 (en) | 2007-10-31 | 2014-02-24 | Use and production of citrate-stable neutral metalloproteases |
US15/834,446 US20180094216A1 (en) | 2007-10-31 | 2017-12-07 | Use and production of citrate-stable neutral metalloproteases |
US16/798,761 US20200231908A1 (en) | 2007-10-31 | 2020-02-24 | Use and production of citrate-stable neutral metalloproteases |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US98404607P | 2007-10-31 | 2007-10-31 | |
US60/984,046 | 2007-10-31 |
Related Child Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US12/681,614 A-371-Of-International US20110081454A1 (en) | 2007-10-31 | 2008-10-23 | Use and production of citrate-stable neutral metalloproteases |
US14/187,625 Continuation US20140315775A1 (en) | 2007-10-31 | 2014-02-24 | Use and production of citrate-stable neutral metalloproteases |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2009058661A1 true WO2009058661A1 (en) | 2009-05-07 |
Family
ID=40276163
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2008/080972 WO2009058661A1 (en) | 2007-10-31 | 2008-10-23 | Use and production of citrate-stable neutral metalloproteases |
Country Status (11)
Country | Link |
---|---|
US (4) | US20110081454A1 (en) |
EP (1) | EP2205731B1 (en) |
JP (1) | JP5498951B2 (en) |
KR (1) | KR20100075986A (en) |
CN (1) | CN101842481B (en) |
BR (1) | BRPI0818788A2 (en) |
CA (1) | CA2703975C (en) |
DK (1) | DK2205731T3 (en) |
MX (1) | MX2010004372A (en) |
RU (1) | RU2010121930A (en) |
WO (1) | WO2009058661A1 (en) |
Cited By (101)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2012110562A3 (en) * | 2011-02-16 | 2012-11-15 | Novozymes A/S | Detergent compositions comprising metalloproteases |
WO2015066667A1 (en) | 2013-11-04 | 2015-05-07 | Danisco Us Inc. | Proteases in wheat processing |
WO2015066669A1 (en) | 2013-11-04 | 2015-05-07 | Danisco Us Inc. | Proteases in corn processing |
WO2015089441A1 (en) | 2013-12-13 | 2015-06-18 | Danisco Us Inc. | Serine proteases of bacillus species |
WO2015089447A1 (en) | 2013-12-13 | 2015-06-18 | Danisco Us Inc. | Serine proteases of the bacillus gibsonii-clade |
WO2015095358A1 (en) | 2013-12-18 | 2015-06-25 | E. I. Du Pont De Nemours And Company | Cationic poly alpha-1,3-glucan ethers |
WO2015123323A1 (en) | 2014-02-14 | 2015-08-20 | E. I. Du Pont De Nemours And Company | Poly-alpha-1,3-1,6-glucans for viscosity modification |
WO2015138283A1 (en) | 2014-03-11 | 2015-09-17 | E. I. Du Pont De Nemours And Company | Oxidized poly alpha-1,3-glucan as detergent builder |
WO2015195960A1 (en) | 2014-06-19 | 2015-12-23 | E. I. Du Pont De Nemours And Company | Compositions containing one or more poly alpha-1,3-glucan ether compounds |
WO2015195777A1 (en) | 2014-06-19 | 2015-12-23 | E. I. Du Pont De Nemours And Company | Compositions containing one or more poly alpha-1,3-glucan ether compounds |
WO2016061438A1 (en) | 2014-10-17 | 2016-04-21 | Danisco Us Inc. | Serine proteases of bacillus species |
WO2016069557A1 (en) | 2014-10-27 | 2016-05-06 | Danisco Us Inc. | Serine proteases of bacillus species |
WO2016069548A2 (en) | 2014-10-27 | 2016-05-06 | Danisco Us Inc. | Serine proteases |
WO2016069552A1 (en) | 2014-10-27 | 2016-05-06 | Danisco Us Inc. | Serine proteases |
WO2016069569A2 (en) | 2014-10-27 | 2016-05-06 | Danisco Us Inc. | Serine proteases |
WO2016069544A1 (en) | 2014-10-27 | 2016-05-06 | Danisco Us Inc. | Serine proteases |
EP3034592A1 (en) | 2014-12-17 | 2016-06-22 | The Procter and Gamble Company | Method of automatic dishwashing |
EP3034591A1 (en) | 2014-12-17 | 2016-06-22 | The Procter and Gamble Company | Method of automatic dishwashing |
EP3034596A1 (en) | 2014-12-17 | 2016-06-22 | The Procter and Gamble Company | Detergent composition |
EP3034588A1 (en) | 2014-12-17 | 2016-06-22 | The Procter and Gamble Company | Detergent composition |
EP3034590A1 (en) | 2014-12-17 | 2016-06-22 | The Procter and Gamble Company | Method of automatic dishwashing |
EP3034589A1 (en) | 2014-12-17 | 2016-06-22 | The Procter and Gamble Company | Detergent composition |
EP3034597A1 (en) | 2014-12-17 | 2016-06-22 | The Procter and Gamble Company | Detergent composition |
WO2016106011A1 (en) | 2014-12-23 | 2016-06-30 | E. I. Du Pont De Nemours And Company | Enzymatically produced cellulose |
EP3098295A1 (en) | 2015-05-29 | 2016-11-30 | The Procter and Gamble Company | Process for making a single or multi-compartment pouch |
EP3098296A1 (en) | 2015-05-29 | 2016-11-30 | The Procter and Gamble Company | Process for making a multi-compartment pouch |
WO2016201040A1 (en) | 2015-06-09 | 2016-12-15 | Danisco Us Inc. | Water-triggered enzyme suspension |
WO2016201044A1 (en) | 2015-06-09 | 2016-12-15 | Danisco Us Inc | Osmotic burst encapsulates |
WO2016201069A1 (en) | 2015-06-09 | 2016-12-15 | Danisco Us Inc | Low-density enzyme-containing particles |
WO2016205755A1 (en) | 2015-06-17 | 2016-12-22 | Danisco Us Inc. | Bacillus gibsonii-clade serine proteases |
WO2017079751A1 (en) | 2015-11-05 | 2017-05-11 | Danisco Us Inc | Paenibacillus sp. mannanases |
WO2017079756A1 (en) | 2015-11-05 | 2017-05-11 | Danisco Us Inc | Paenibacillus and bacillus spp. mannanases |
WO2017083229A1 (en) | 2015-11-13 | 2017-05-18 | E. I. Du Pont De Nemours And Company | Glucan fiber compositions for use in laundry care and fabric care |
WO2017083228A1 (en) | 2015-11-13 | 2017-05-18 | E. I. Du Pont De Nemours And Company | Glucan fiber compositions for use in laundry care and fabric care |
WO2017083226A1 (en) | 2015-11-13 | 2017-05-18 | E. I. Du Pont De Nemours And Company | Glucan fiber compositions for use in laundry care and fabric care |
EP3181678A1 (en) | 2015-12-17 | 2017-06-21 | The Procter and Gamble Company | Process for making a detergent powder |
EP3181675A1 (en) | 2015-12-17 | 2017-06-21 | The Procter and Gamble Company | Automatic dishwashing detergent composition |
EP3181670A1 (en) | 2015-12-17 | 2017-06-21 | The Procter and Gamble Company | Automatic dishwashing detergent composition |
EP3181679A1 (en) | 2015-12-17 | 2017-06-21 | The Procter and Gamble Company | Process for making an automatic dishwashing product |
EP3181671A1 (en) | 2015-12-17 | 2017-06-21 | The Procter and Gamble Company | Automatic dishwashing detergent composition |
EP3181676A1 (en) | 2015-12-17 | 2017-06-21 | The Procter and Gamble Company | Automatic dishwashing detergent composition |
EP3181672A1 (en) | 2015-12-17 | 2017-06-21 | The Procter and Gamble Company | Automatic dishwashing detergent composition |
WO2017106676A1 (en) | 2015-12-18 | 2017-06-22 | Danisco Us Inc | Polypeptides with endoglucanase activity and uses thereof |
EP3184622A1 (en) | 2015-12-22 | 2017-06-28 | The Procter and Gamble Company | Automatic dishwashing composition |
WO2017192300A1 (en) | 2016-05-05 | 2017-11-09 | Danisco Us Inc | Protease variants and uses thereof |
WO2017192692A1 (en) | 2016-05-03 | 2017-11-09 | Danisco Us Inc | Protease variants and uses thereof |
WO2017210295A1 (en) | 2016-05-31 | 2017-12-07 | Danisco Us Inc. | Protease variants and uses thereof |
EP3257931A1 (en) | 2016-06-17 | 2017-12-20 | The Procter and Gamble Company | Detergent composition |
EP3257930A1 (en) | 2016-06-17 | 2017-12-20 | The Procter and Gamble Company | Cleaning pouch |
EP3257929A1 (en) | 2016-06-17 | 2017-12-20 | The Procter and Gamble Company | Automatic dishwashing detergent composition |
EP3257928A1 (en) | 2016-06-17 | 2017-12-20 | The Procter and Gamble Company | Automatic dishwashing detergent composition |
EP3257923A1 (en) | 2016-06-17 | 2017-12-20 | The Procter and Gamble Company | Automatic dishwashing detergent composition |
WO2017219011A1 (en) | 2016-06-17 | 2017-12-21 | Danisco Us Inc | Protease variants and uses thereof |
WO2018085524A2 (en) | 2016-11-07 | 2018-05-11 | Danisco Us Inc | Laundry detergent composition |
EP3339421A1 (en) | 2016-12-22 | 2018-06-27 | The Procter & Gamble Company | Laundry detergent composition |
EP3339418A1 (en) | 2016-12-22 | 2018-06-27 | The Procter & Gamble Company | Laundry detergent composition |
EP3339407A1 (en) | 2016-12-22 | 2018-06-27 | The Procter & Gamble Company | Laundry detergent composition |
EP3339417A1 (en) | 2016-12-22 | 2018-06-27 | The Procter & Gamble Company | Laundry detergent composition |
EP3339416A1 (en) | 2016-12-22 | 2018-06-27 | The Procter & Gamble Company | Laundry detergent composition |
EP3339414A1 (en) | 2016-12-22 | 2018-06-27 | The Procter & Gamble Company | Laundry detergent composition |
EP3339413A1 (en) | 2016-12-22 | 2018-06-27 | The Procter & Gamble Company | Laundry detergent composition |
EP3339419A1 (en) | 2016-12-22 | 2018-06-27 | The Procter & Gamble Company | Laundry detergent composition |
EP3339415A1 (en) | 2016-12-22 | 2018-06-27 | The Procter & Gamble Company | Laundry detergent composition |
WO2018118917A1 (en) | 2016-12-21 | 2018-06-28 | Danisco Us Inc. | Protease variants and uses thereof |
WO2018118825A1 (en) | 2016-12-22 | 2018-06-28 | The Procter & Gamble Company | Laundry detergent composition |
WO2018118950A1 (en) | 2016-12-21 | 2018-06-28 | Danisco Us Inc. | Bacillus gibsonii-clade serine proteases |
WO2018183662A1 (en) | 2017-03-31 | 2018-10-04 | Danisco Us Inc | Delayed release enzyme formulations for bleach-containing detergents |
WO2018184004A1 (en) | 2017-03-31 | 2018-10-04 | Danisco Us Inc | Alpha-amylase combinatorial variants |
WO2019006077A1 (en) | 2017-06-30 | 2019-01-03 | Danisco Us Inc | Low-agglomeration, enzyme-containing particles |
WO2019036721A2 (en) | 2017-08-18 | 2019-02-21 | Danisco Us Inc | Alpha-amylase variants |
WO2019108599A1 (en) | 2017-11-29 | 2019-06-06 | Danisco Us Inc | Subtilisin variants having improved stability |
WO2019125683A1 (en) | 2017-12-21 | 2019-06-27 | Danisco Us Inc | Enzyme-containing, hot-melt granules comprising a thermotolerant desiccant |
WO2019156670A1 (en) | 2018-02-08 | 2019-08-15 | Danisco Us Inc. | Thermally-resistant wax matrix particles for enzyme encapsulation |
WO2019245704A1 (en) | 2018-06-19 | 2019-12-26 | Danisco Us Inc | Subtilisin variants |
WO2019245705A1 (en) | 2018-06-19 | 2019-12-26 | Danisco Us Inc | Subtilisin variants |
EP3587569A1 (en) | 2014-03-21 | 2020-01-01 | Danisco US Inc. | Serine proteases of bacillus species |
WO2020028443A1 (en) | 2018-07-31 | 2020-02-06 | Danisco Us Inc | Variant alpha-amylases having amino acid substitutions that lower the pka of the general acid |
WO2020047215A1 (en) | 2018-08-30 | 2020-03-05 | Danisco Us Inc | Enzyme-containing granules |
WO2020068486A1 (en) | 2018-09-27 | 2020-04-02 | Danisco Us Inc | Compositions for medical instrument cleaning |
WO2020077331A2 (en) | 2018-10-12 | 2020-04-16 | Danisco Us Inc | Alpha-amylases with mutations that improve stability in the presence of chelants |
WO2020112599A1 (en) | 2018-11-28 | 2020-06-04 | Danisco Us Inc | Subtilisin variants having improved stability |
US10696958B2 (en) | 2013-05-29 | 2020-06-30 | Danisco Us Inc | Metalloproteases |
WO2020242858A1 (en) | 2019-05-24 | 2020-12-03 | Danisco Us Inc | Subtilisin variants and methods of use |
WO2020247582A1 (en) | 2019-06-06 | 2020-12-10 | Danisco Us Inc | Methods and compositions for cleaning |
WO2021080948A2 (en) | 2019-10-24 | 2021-04-29 | Danisco Us Inc | Variant maltopentaose/maltohexaose-forming alpha-amylases |
EP3872174A1 (en) | 2015-05-13 | 2021-09-01 | Danisco US Inc. | Aprl-clade protease variants and uses thereof |
WO2022047149A1 (en) | 2020-08-27 | 2022-03-03 | Danisco Us Inc | Enzymes and enzyme compositions for cleaning |
WO2022165107A1 (en) | 2021-01-29 | 2022-08-04 | Danisco Us Inc | Compositions for cleaning and methods related thereto |
WO2023278297A1 (en) | 2021-06-30 | 2023-01-05 | Danisco Us Inc | Variant lipases and uses thereof |
WO2023034486A2 (en) | 2021-09-03 | 2023-03-09 | Danisco Us Inc. | Laundry compositions for cleaning |
WO2023039270A2 (en) | 2021-09-13 | 2023-03-16 | Danisco Us Inc. | Bioactive-containing granules |
EP4163305A1 (en) | 2013-12-16 | 2023-04-12 | Nutrition & Biosciences USA 4, Inc. | Use of poly alpha-1,3-glucan ethers as viscosity modifiers |
WO2023114939A2 (en) | 2021-12-16 | 2023-06-22 | Danisco Us Inc. | Subtilisin variants and methods of use |
WO2023114988A2 (en) | 2021-12-16 | 2023-06-22 | Danisco Us Inc. | Variant maltopentaose/maltohexaose-forming alpha-amylases |
WO2023114936A2 (en) | 2021-12-16 | 2023-06-22 | Danisco Us Inc. | Subtilisin variants and methods of use |
WO2023114932A2 (en) | 2021-12-16 | 2023-06-22 | Danisco Us Inc. | Subtilisin variants and methods of use |
WO2023168234A1 (en) | 2022-03-01 | 2023-09-07 | Danisco Us Inc. | Enzymes and enzyme compositions for cleaning |
WO2023250301A1 (en) | 2022-06-21 | 2023-12-28 | Danisco Us Inc. | Methods and compositions for cleaning comprising a polypeptide having thermolysin activity |
WO2024050346A1 (en) | 2022-09-02 | 2024-03-07 | Danisco Us Inc. | Detergent compositions and methods related thereto |
WO2024050339A1 (en) | 2022-09-02 | 2024-03-07 | Danisco Us Inc. | Mannanase variants and methods of use |
WO2024050343A1 (en) | 2022-09-02 | 2024-03-07 | Danisco Us Inc. | Subtilisin variants and methods related thereto |
Families Citing this family (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20140038876A1 (en) * | 2011-02-16 | 2014-02-06 | Novozymes A/S | Detergent Compositions Comprising Mettaloproteases |
US20160108387A1 (en) * | 2013-05-29 | 2016-04-21 | Danisco Us Inc. | Novel metalloproteases |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP0357157A2 (en) * | 1983-06-24 | 1990-03-07 | Genencor International, Inc. | Procaryotic carbonyl hydrolases and mutants thereof, and methods for producing and using them |
WO2007044993A2 (en) | 2005-10-12 | 2007-04-19 | Genencor International, Inc. | Use and production of storage-stable neutral metalloprotease |
Family Cites Families (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4771003A (en) * | 1985-10-22 | 1988-09-13 | Genex Corporation | Heat stable alkaline proteases produced by a bacillus |
US4822516A (en) * | 1986-12-08 | 1989-04-18 | Kao Corporation | Detergent composition for clothing incorporating a cellulase |
EP1783223A1 (en) * | 1998-10-05 | 2007-05-09 | Novozymes A/S | Fungal transcriptional activator PRTT from Aspergillus niger, useful in methods for producing polypeptides |
-
2008
- 2008-10-23 RU RU2010121930/10A patent/RU2010121930A/en not_active Application Discontinuation
- 2008-10-23 BR BRPI0818788A patent/BRPI0818788A2/en not_active Application Discontinuation
- 2008-10-23 JP JP2010532153A patent/JP5498951B2/en active Active
- 2008-10-23 US US12/681,614 patent/US20110081454A1/en not_active Abandoned
- 2008-10-23 CA CA2703975A patent/CA2703975C/en active Active
- 2008-10-23 EP EP08845861A patent/EP2205731B1/en active Active
- 2008-10-23 CN CN200880114393.1A patent/CN101842481B/en active Active
- 2008-10-23 MX MX2010004372A patent/MX2010004372A/en active IP Right Grant
- 2008-10-23 DK DK08845861.7T patent/DK2205731T3/en active
- 2008-10-23 WO PCT/US2008/080972 patent/WO2009058661A1/en active Application Filing
- 2008-10-23 KR KR1020107009563A patent/KR20100075986A/en active IP Right Grant
-
2014
- 2014-02-24 US US14/187,625 patent/US20140315775A1/en not_active Abandoned
-
2017
- 2017-12-07 US US15/834,446 patent/US20180094216A1/en not_active Abandoned
-
2020
- 2020-02-24 US US16/798,761 patent/US20200231908A1/en not_active Abandoned
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP0357157A2 (en) * | 1983-06-24 | 1990-03-07 | Genencor International, Inc. | Procaryotic carbonyl hydrolases and mutants thereof, and methods for producing and using them |
WO2007044993A2 (en) | 2005-10-12 | 2007-04-19 | Genencor International, Inc. | Use and production of storage-stable neutral metalloprotease |
Non-Patent Citations (3)
Title |
---|
HONJO M ET AL: "Cloning and expression of the gene for neutral protease of Bacillus amyloliquefaciens in Bacillus subtilis", JOURNAL OF BIOTECHNOLOGY, ELSEVIER SCIENCE PUBLISHERS, AMSTERDAM, NL, vol. 1, no. 5-6, 1 December 1984 (1984-12-01), pages 265 - 277, XP023944388, ISSN: 0168-1656, [retrieved on 19841201] * |
IMANAKA T ET AL: "A NEW WAY ENHANCING THE THERMOSTABILITY OF PROTEASES", NATURE, NATURE PUBLISHING GROUP, LONDON, UK, vol. 324, no. 6098, 18 December 1986 (1986-12-18), pages 695 - 697, XP001026149, ISSN: 0028-0836 * |
KUBO M ET AL: "ALTERATION OF SPECIFIC ACTIVITY AND STABILITY OF THERMOSTABLE NEUTRAL PROTEASE BY SITE-DIRECTED MUTAGENESIS", APPLIED AND ENVIRONMENTAL MICROBIOLOGY, AMERICAN SOCIETY FOR MICROBIOLOGY, US, vol. 58, no. 11, 1 January 1992 (1992-01-01), pages 3779 - 3783, XP000914629, ISSN: 0099-2240 * |
Cited By (138)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JP2014508830A (en) * | 2011-02-16 | 2014-04-10 | ノボザイムス アクティーゼルスカブ | Detergent composition containing metalloprotease |
WO2012110562A3 (en) * | 2011-02-16 | 2012-11-15 | Novozymes A/S | Detergent compositions comprising metalloproteases |
US10696958B2 (en) | 2013-05-29 | 2020-06-30 | Danisco Us Inc | Metalloproteases |
WO2015066667A1 (en) | 2013-11-04 | 2015-05-07 | Danisco Us Inc. | Proteases in wheat processing |
WO2015066669A1 (en) | 2013-11-04 | 2015-05-07 | Danisco Us Inc. | Proteases in corn processing |
EP3553173A1 (en) | 2013-12-13 | 2019-10-16 | Danisco US Inc. | Serine proteases of the bacillus gibsonii-clade |
WO2015089447A1 (en) | 2013-12-13 | 2015-06-18 | Danisco Us Inc. | Serine proteases of the bacillus gibsonii-clade |
EP3910057A1 (en) | 2013-12-13 | 2021-11-17 | Danisco US Inc. | Serine proteases of the bacillus gibsonii-clade |
WO2015089441A1 (en) | 2013-12-13 | 2015-06-18 | Danisco Us Inc. | Serine proteases of bacillus species |
EP3514230A1 (en) | 2013-12-13 | 2019-07-24 | Danisco US Inc. | Serine proteases of bacillus species |
EP4163305A1 (en) | 2013-12-16 | 2023-04-12 | Nutrition & Biosciences USA 4, Inc. | Use of poly alpha-1,3-glucan ethers as viscosity modifiers |
WO2015095358A1 (en) | 2013-12-18 | 2015-06-25 | E. I. Du Pont De Nemours And Company | Cationic poly alpha-1,3-glucan ethers |
EP3789407A1 (en) | 2013-12-18 | 2021-03-10 | Nutrition & Biosciences USA 4, Inc. | Cationic poly alpha-1,3-glucan ethers |
WO2015123323A1 (en) | 2014-02-14 | 2015-08-20 | E. I. Du Pont De Nemours And Company | Poly-alpha-1,3-1,6-glucans for viscosity modification |
WO2015138283A1 (en) | 2014-03-11 | 2015-09-17 | E. I. Du Pont De Nemours And Company | Oxidized poly alpha-1,3-glucan as detergent builder |
EP4155398A1 (en) | 2014-03-21 | 2023-03-29 | Danisco US Inc. | Serine proteases of bacillus species |
EP3587569A1 (en) | 2014-03-21 | 2020-01-01 | Danisco US Inc. | Serine proteases of bacillus species |
EP3919599A1 (en) | 2014-06-19 | 2021-12-08 | Nutrition & Biosciences USA 4, Inc. | Compositions containing one or more poly alpha-1,3-glucan ether compounds |
WO2015195777A1 (en) | 2014-06-19 | 2015-12-23 | E. I. Du Pont De Nemours And Company | Compositions containing one or more poly alpha-1,3-glucan ether compounds |
WO2015195960A1 (en) | 2014-06-19 | 2015-12-23 | E. I. Du Pont De Nemours And Company | Compositions containing one or more poly alpha-1,3-glucan ether compounds |
WO2016061438A1 (en) | 2014-10-17 | 2016-04-21 | Danisco Us Inc. | Serine proteases of bacillus species |
WO2016069544A1 (en) | 2014-10-27 | 2016-05-06 | Danisco Us Inc. | Serine proteases |
WO2016069569A2 (en) | 2014-10-27 | 2016-05-06 | Danisco Us Inc. | Serine proteases |
WO2016069552A1 (en) | 2014-10-27 | 2016-05-06 | Danisco Us Inc. | Serine proteases |
WO2016069548A2 (en) | 2014-10-27 | 2016-05-06 | Danisco Us Inc. | Serine proteases |
WO2016069557A1 (en) | 2014-10-27 | 2016-05-06 | Danisco Us Inc. | Serine proteases of bacillus species |
EP3550017A1 (en) | 2014-10-27 | 2019-10-09 | Danisco US Inc. | Serine proteases |
WO2016099861A1 (en) | 2014-12-17 | 2016-06-23 | The Procter & Gamble Company | Method of automatic dishwashing |
EP3034589A1 (en) | 2014-12-17 | 2016-06-22 | The Procter and Gamble Company | Detergent composition |
WO2016100324A1 (en) | 2014-12-17 | 2016-06-23 | The Procter & Gamble Company | Method of automatic dishwashing |
US20160177236A1 (en) * | 2014-12-17 | 2016-06-23 | The Procter & Gamble Company | Detergent composition |
WO2016100323A1 (en) | 2014-12-17 | 2016-06-23 | The Procter & Gamble Company | Detergent composition |
EP3034592A1 (en) | 2014-12-17 | 2016-06-22 | The Procter and Gamble Company | Method of automatic dishwashing |
EP3034591A1 (en) | 2014-12-17 | 2016-06-22 | The Procter and Gamble Company | Method of automatic dishwashing |
EP3034596A1 (en) | 2014-12-17 | 2016-06-22 | The Procter and Gamble Company | Detergent composition |
EP3034588A1 (en) | 2014-12-17 | 2016-06-22 | The Procter and Gamble Company | Detergent composition |
EP3034590A1 (en) | 2014-12-17 | 2016-06-22 | The Procter and Gamble Company | Method of automatic dishwashing |
WO2016099858A1 (en) | 2014-12-17 | 2016-06-23 | The Procter & Gamble Company | Detergent composition |
EP3034597A1 (en) | 2014-12-17 | 2016-06-22 | The Procter and Gamble Company | Detergent composition |
US10662398B2 (en) * | 2014-12-17 | 2020-05-26 | The Procter & Gamble Company | Detergent composition |
WO2016099859A1 (en) | 2014-12-17 | 2016-06-23 | The Procter & Gamble Company | Detergent composition |
WO2016099860A1 (en) | 2014-12-17 | 2016-06-23 | The Procter & Gamble Company | Method of automatic dishwashing |
WO2016100320A1 (en) | 2014-12-17 | 2016-06-23 | The Procter & Gamble Company | Detergent composition |
WO2016106011A1 (en) | 2014-12-23 | 2016-06-30 | E. I. Du Pont De Nemours And Company | Enzymatically produced cellulose |
EP4219704A2 (en) | 2015-05-13 | 2023-08-02 | Danisco US Inc | Aprl-clade protease variants and uses thereof |
EP3872174A1 (en) | 2015-05-13 | 2021-09-01 | Danisco US Inc. | Aprl-clade protease variants and uses thereof |
WO2016196049A1 (en) | 2015-05-29 | 2016-12-08 | The Procter & Gamble Company | Process for making a multi-compartment pouch |
WO2016195827A1 (en) | 2015-05-29 | 2016-12-08 | The Procter & Gamble Company | Process for making a single or multi-compartment pouch |
EP3098296A1 (en) | 2015-05-29 | 2016-11-30 | The Procter and Gamble Company | Process for making a multi-compartment pouch |
EP3098295A1 (en) | 2015-05-29 | 2016-11-30 | The Procter and Gamble Company | Process for making a single or multi-compartment pouch |
WO2016201069A1 (en) | 2015-06-09 | 2016-12-15 | Danisco Us Inc | Low-density enzyme-containing particles |
WO2016201044A1 (en) | 2015-06-09 | 2016-12-15 | Danisco Us Inc | Osmotic burst encapsulates |
WO2016201040A1 (en) | 2015-06-09 | 2016-12-15 | Danisco Us Inc. | Water-triggered enzyme suspension |
WO2016205755A1 (en) | 2015-06-17 | 2016-12-22 | Danisco Us Inc. | Bacillus gibsonii-clade serine proteases |
EP4234693A2 (en) | 2015-06-17 | 2023-08-30 | Danisco US Inc | Bacillus gibsonii-clade serine proteases |
EP4141113A1 (en) | 2015-11-05 | 2023-03-01 | Danisco US Inc | Paenibacillus sp. mannanases |
WO2017079751A1 (en) | 2015-11-05 | 2017-05-11 | Danisco Us Inc | Paenibacillus sp. mannanases |
WO2017079756A1 (en) | 2015-11-05 | 2017-05-11 | Danisco Us Inc | Paenibacillus and bacillus spp. mannanases |
WO2017083229A1 (en) | 2015-11-13 | 2017-05-18 | E. I. Du Pont De Nemours And Company | Glucan fiber compositions for use in laundry care and fabric care |
WO2017083228A1 (en) | 2015-11-13 | 2017-05-18 | E. I. Du Pont De Nemours And Company | Glucan fiber compositions for use in laundry care and fabric care |
WO2017083226A1 (en) | 2015-11-13 | 2017-05-18 | E. I. Du Pont De Nemours And Company | Glucan fiber compositions for use in laundry care and fabric care |
US10822574B2 (en) | 2015-11-13 | 2020-11-03 | Dupont Industrial Biosciences Usa, Llc | Glucan fiber compositions for use in laundry care and fabric care |
US10844324B2 (en) | 2015-11-13 | 2020-11-24 | Dupont Industrial Biosciences Usa, Llc | Glucan fiber compositions for use in laundry care and fabric care |
US10876074B2 (en) | 2015-11-13 | 2020-12-29 | Dupont Industrial Biosciences Usa, Llc | Glucan fiber compositions for use in laundry care and fabric care |
EP3181678A1 (en) | 2015-12-17 | 2017-06-21 | The Procter and Gamble Company | Process for making a detergent powder |
WO2017105826A1 (en) | 2015-12-17 | 2017-06-22 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
EP3181672A1 (en) | 2015-12-17 | 2017-06-21 | The Procter and Gamble Company | Automatic dishwashing detergent composition |
EP3181671A1 (en) | 2015-12-17 | 2017-06-21 | The Procter and Gamble Company | Automatic dishwashing detergent composition |
EP3181679A1 (en) | 2015-12-17 | 2017-06-21 | The Procter and Gamble Company | Process for making an automatic dishwashing product |
EP3181670A1 (en) | 2015-12-17 | 2017-06-21 | The Procter and Gamble Company | Automatic dishwashing detergent composition |
EP3181675A1 (en) | 2015-12-17 | 2017-06-21 | The Procter and Gamble Company | Automatic dishwashing detergent composition |
WO2017105825A1 (en) | 2015-12-17 | 2017-06-22 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
WO2017105827A1 (en) | 2015-12-17 | 2017-06-22 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
EP3181676A1 (en) | 2015-12-17 | 2017-06-21 | The Procter and Gamble Company | Automatic dishwashing detergent composition |
WO2017105828A1 (en) | 2015-12-17 | 2017-06-22 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
WO2017106676A1 (en) | 2015-12-18 | 2017-06-22 | Danisco Us Inc | Polypeptides with endoglucanase activity and uses thereof |
EP3184622A1 (en) | 2015-12-22 | 2017-06-28 | The Procter and Gamble Company | Automatic dishwashing composition |
WO2017192692A1 (en) | 2016-05-03 | 2017-11-09 | Danisco Us Inc | Protease variants and uses thereof |
WO2017192300A1 (en) | 2016-05-05 | 2017-11-09 | Danisco Us Inc | Protease variants and uses thereof |
EP3845642A1 (en) | 2016-05-05 | 2021-07-07 | Danisco US Inc. | Protease variants and uses thereof |
WO2017210295A1 (en) | 2016-05-31 | 2017-12-07 | Danisco Us Inc. | Protease variants and uses thereof |
WO2017218719A1 (en) | 2016-06-17 | 2017-12-21 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
EP3257923A1 (en) | 2016-06-17 | 2017-12-20 | The Procter and Gamble Company | Automatic dishwashing detergent composition |
WO2017218861A1 (en) | 2016-06-17 | 2017-12-21 | The Procter & Gamble Company | Detergent composition |
EP3257931A1 (en) | 2016-06-17 | 2017-12-20 | The Procter and Gamble Company | Detergent composition |
WO2017219011A1 (en) | 2016-06-17 | 2017-12-21 | Danisco Us Inc | Protease variants and uses thereof |
EP3257930A1 (en) | 2016-06-17 | 2017-12-20 | The Procter and Gamble Company | Cleaning pouch |
EP4151726A1 (en) | 2016-06-17 | 2023-03-22 | Danisco US Inc | Protease variants and uses thereof |
EP3257929A1 (en) | 2016-06-17 | 2017-12-20 | The Procter and Gamble Company | Automatic dishwashing detergent composition |
EP3257928A1 (en) | 2016-06-17 | 2017-12-20 | The Procter and Gamble Company | Automatic dishwashing detergent composition |
WO2018085524A2 (en) | 2016-11-07 | 2018-05-11 | Danisco Us Inc | Laundry detergent composition |
WO2018112123A1 (en) | 2016-12-15 | 2018-06-21 | Danisco Us Inc. | Polypeptides with endoglucanase activity and uses thereof |
EP4212622A2 (en) | 2016-12-21 | 2023-07-19 | Danisco US Inc. | Bacillus gibsonii-clade serine proteases |
WO2018118950A1 (en) | 2016-12-21 | 2018-06-28 | Danisco Us Inc. | Bacillus gibsonii-clade serine proteases |
WO2018118917A1 (en) | 2016-12-21 | 2018-06-28 | Danisco Us Inc. | Protease variants and uses thereof |
EP3339421A1 (en) | 2016-12-22 | 2018-06-27 | The Procter & Gamble Company | Laundry detergent composition |
EP3339415A1 (en) | 2016-12-22 | 2018-06-27 | The Procter & Gamble Company | Laundry detergent composition |
WO2018118825A1 (en) | 2016-12-22 | 2018-06-28 | The Procter & Gamble Company | Laundry detergent composition |
EP3339413A1 (en) | 2016-12-22 | 2018-06-27 | The Procter & Gamble Company | Laundry detergent composition |
EP3339419A1 (en) | 2016-12-22 | 2018-06-27 | The Procter & Gamble Company | Laundry detergent composition |
EP3339420A1 (en) | 2016-12-22 | 2018-06-27 | The Procter & Gamble Company | Laundry detergent composition |
WO2018118824A1 (en) | 2016-12-22 | 2018-06-28 | The Procter & Gamble Company | Laundry detergent composition |
EP3339418A1 (en) | 2016-12-22 | 2018-06-27 | The Procter & Gamble Company | Laundry detergent composition |
EP3339414A1 (en) | 2016-12-22 | 2018-06-27 | The Procter & Gamble Company | Laundry detergent composition |
EP3339407A1 (en) | 2016-12-22 | 2018-06-27 | The Procter & Gamble Company | Laundry detergent composition |
EP3339416A1 (en) | 2016-12-22 | 2018-06-27 | The Procter & Gamble Company | Laundry detergent composition |
EP3339417A1 (en) | 2016-12-22 | 2018-06-27 | The Procter & Gamble Company | Laundry detergent composition |
WO2018183662A1 (en) | 2017-03-31 | 2018-10-04 | Danisco Us Inc | Delayed release enzyme formulations for bleach-containing detergents |
WO2018184004A1 (en) | 2017-03-31 | 2018-10-04 | Danisco Us Inc | Alpha-amylase combinatorial variants |
WO2019006077A1 (en) | 2017-06-30 | 2019-01-03 | Danisco Us Inc | Low-agglomeration, enzyme-containing particles |
WO2019036721A2 (en) | 2017-08-18 | 2019-02-21 | Danisco Us Inc | Alpha-amylase variants |
WO2019108599A1 (en) | 2017-11-29 | 2019-06-06 | Danisco Us Inc | Subtilisin variants having improved stability |
WO2019125683A1 (en) | 2017-12-21 | 2019-06-27 | Danisco Us Inc | Enzyme-containing, hot-melt granules comprising a thermotolerant desiccant |
WO2019156670A1 (en) | 2018-02-08 | 2019-08-15 | Danisco Us Inc. | Thermally-resistant wax matrix particles for enzyme encapsulation |
WO2019245704A1 (en) | 2018-06-19 | 2019-12-26 | Danisco Us Inc | Subtilisin variants |
WO2019245705A1 (en) | 2018-06-19 | 2019-12-26 | Danisco Us Inc | Subtilisin variants |
WO2020028443A1 (en) | 2018-07-31 | 2020-02-06 | Danisco Us Inc | Variant alpha-amylases having amino acid substitutions that lower the pka of the general acid |
WO2020047215A1 (en) | 2018-08-30 | 2020-03-05 | Danisco Us Inc | Enzyme-containing granules |
WO2020068486A1 (en) | 2018-09-27 | 2020-04-02 | Danisco Us Inc | Compositions for medical instrument cleaning |
WO2020077331A2 (en) | 2018-10-12 | 2020-04-16 | Danisco Us Inc | Alpha-amylases with mutations that improve stability in the presence of chelants |
WO2020112599A1 (en) | 2018-11-28 | 2020-06-04 | Danisco Us Inc | Subtilisin variants having improved stability |
WO2020242858A1 (en) | 2019-05-24 | 2020-12-03 | Danisco Us Inc | Subtilisin variants and methods of use |
WO2020247582A1 (en) | 2019-06-06 | 2020-12-10 | Danisco Us Inc | Methods and compositions for cleaning |
WO2021080948A2 (en) | 2019-10-24 | 2021-04-29 | Danisco Us Inc | Variant maltopentaose/maltohexaose-forming alpha-amylases |
WO2022047149A1 (en) | 2020-08-27 | 2022-03-03 | Danisco Us Inc | Enzymes and enzyme compositions for cleaning |
WO2022165107A1 (en) | 2021-01-29 | 2022-08-04 | Danisco Us Inc | Compositions for cleaning and methods related thereto |
WO2023278297A1 (en) | 2021-06-30 | 2023-01-05 | Danisco Us Inc | Variant lipases and uses thereof |
WO2023034486A2 (en) | 2021-09-03 | 2023-03-09 | Danisco Us Inc. | Laundry compositions for cleaning |
WO2023039270A2 (en) | 2021-09-13 | 2023-03-16 | Danisco Us Inc. | Bioactive-containing granules |
WO2023114936A2 (en) | 2021-12-16 | 2023-06-22 | Danisco Us Inc. | Subtilisin variants and methods of use |
WO2023114932A2 (en) | 2021-12-16 | 2023-06-22 | Danisco Us Inc. | Subtilisin variants and methods of use |
WO2023114988A2 (en) | 2021-12-16 | 2023-06-22 | Danisco Us Inc. | Variant maltopentaose/maltohexaose-forming alpha-amylases |
WO2023114939A2 (en) | 2021-12-16 | 2023-06-22 | Danisco Us Inc. | Subtilisin variants and methods of use |
WO2023168234A1 (en) | 2022-03-01 | 2023-09-07 | Danisco Us Inc. | Enzymes and enzyme compositions for cleaning |
WO2023250301A1 (en) | 2022-06-21 | 2023-12-28 | Danisco Us Inc. | Methods and compositions for cleaning comprising a polypeptide having thermolysin activity |
WO2024050346A1 (en) | 2022-09-02 | 2024-03-07 | Danisco Us Inc. | Detergent compositions and methods related thereto |
WO2024050339A1 (en) | 2022-09-02 | 2024-03-07 | Danisco Us Inc. | Mannanase variants and methods of use |
WO2024050343A1 (en) | 2022-09-02 | 2024-03-07 | Danisco Us Inc. | Subtilisin variants and methods related thereto |
Also Published As
Publication number | Publication date |
---|---|
US20200231908A1 (en) | 2020-07-23 |
CN101842481B (en) | 2016-05-11 |
BRPI0818788A2 (en) | 2016-10-25 |
US20110081454A1 (en) | 2011-04-07 |
JP2011502481A (en) | 2011-01-27 |
CN101842481A (en) | 2010-09-22 |
JP5498951B2 (en) | 2014-05-21 |
EP2205731B1 (en) | 2012-12-05 |
CA2703975C (en) | 2018-01-09 |
DK2205731T3 (en) | 2013-03-11 |
CA2703975A1 (en) | 2009-05-07 |
US20180094216A1 (en) | 2018-04-05 |
RU2010121930A (en) | 2011-12-10 |
MX2010004372A (en) | 2010-05-20 |
EP2205731A1 (en) | 2010-07-14 |
KR20100075986A (en) | 2010-07-05 |
US20140315775A1 (en) | 2014-10-23 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20200231908A1 (en) | Use and production of citrate-stable neutral metalloproteases | |
US11091750B2 (en) | Use and production of storage-stable neutral metalloprotease | |
US9976134B2 (en) | Thermolysin variants | |
JP5674462B2 (en) | Methods for improving protein properties | |
US20110104786A1 (en) | Use and production of neutral metalloproteases in a serine protease-free background | |
EP3095859A1 (en) | Compositions and methods comprising variant microbial proteases | |
AU2014202897A1 (en) | Compositions and methods comprising variant microbial proteases |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
WWE | Wipo information: entry into national phase |
Ref document number: 200880114393.1 Country of ref document: CN |
|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 08845861 Country of ref document: EP Kind code of ref document: A1 |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2069/DELNP/2010 Country of ref document: IN |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2008845861 Country of ref document: EP |
|
WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2010/004372 Country of ref document: MX |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2703975 Country of ref document: CA |
|
ENP | Entry into the national phase |
Ref document number: 20107009563 Country of ref document: KR Kind code of ref document: A |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2010532153 Country of ref document: JP |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2010121930 Country of ref document: RU |
|
ENP | Entry into the national phase |
Ref document number: PI0818788 Country of ref document: BR Kind code of ref document: A2 Effective date: 20100428 |